KEGG   Bacteroides salanitronis: Bacsa_2624Help
Entry
Bacsa_2624        CDS       T01433                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
bsa  Bacteroides salanitronis
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bacsa_2624
   00500 Starch and sucrose metabolism
    Bacsa_2624
Enzymes [BR:bsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Bacsa_2624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3050064..3051788
Genome map
AA seq 574 aa AA seqDB search
MKKIHLFCVMLAVLFLSAFKSDRVITIFMIGDSTMANKTLDAGNLERGWGHVLGGYFTED
VRVDNHALNGRSSKSFIDEGHWDEVVSKIKPGDYVFIQFGHNDEKPKPDRHTDPGTTFDE
NLRKFVRETREKGGIPVLFNSVVRRNFGENPNAIAADDFRPEKADAVEEGDTLIDTHGKY
LDSPRNVAKEMDVAFIDLNKATKELVESMGVEGSKKLFMWVPAGVSPACPKGRQDNTHFN
IYGARQVAKLAVQAIEKQIPELGKYVRYYDFVVAKDGSGDFFTVQEAINAVPDFRKNKRT
TILVRKGEYKERVIIPECKINISLIGEEGAVITDDNYASKKNIFGDEMSTSGSSTVYIYA
PDFYAENITFANTAGRVGQAVACFVDGDRAYFKNCRFLGNQDTLYTYGKESRQYYENCYI
EGTVDFIFGWSTALFKDCEIRSLGNGYVTAPSTDQGKPYGYVFWNCRLTADAEADKVYLS
RPWRPYAQAVYIQCELGKHIVPEGWNNWGKASNEKTAFYAEYQSTGEGANPAARAPYSHQ
LTDISKYQPEKVLAGNDGWNPIQNGNALLTNIKR
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattcatttgttttgtgtaatgctggcagttctgttcctgtcggcattcaag
tccgatcgggttatcaccatattcatgatcggcgactctaccatggcaaataagacgctg
gatgccggcaatctcgaaagaggctggggacatgtattgggaggctatttcaccgaagat
gtccgggtagacaatcatgccttgaacggcagaagttcgaaaagctttattgacgaagga
cattgggatgaagtggtcagcaaaatcaagccgggcgactacgtattcatccagttcggg
cacaatgacgaaaagcccaaacccgaccggcacaccgacccgggcacgacgttcgatgaa
aatctccgcaagttcgtacgcgagacacgcgaaaagggaggaatccccgtcttgttcaat
tccgtagtacgccgcaatttcggggaaaatcccaatgccatagccgctgatgacttccgt
cccgagaaagcagatgcggtggaagaaggcgatacgttgattgacacacacgggaaatac
ctcgattctccccgcaacgtagcaaaagaaatggatgtggcattcatcgacctgaacaaa
gcgaccaaagaactggtagaatcaatgggcgtggaaggttcgaagaaactcttcatgtgg
gttcctgccggagtatcgcccgcatgccccaaaggccgtcaggacaatacacactttaat
atttacggagcacgtcaggttgccaaacttgccgtgcaagccatcgaaaaacaaatcccc
gaactgggcaaatacgtgcgttattacgacttcgtagtggctaaagacggaagcggggat
ttctttaccgtgcaagaagccatcaatgccgttccggatttccgcaagaacaaacgtacc
acgattttagtacggaagggagaatacaaggagcgggtcatcattccggaatgcaaaatc
aacatttccctgataggtgaagaaggtgccgtaatcaccgatgacaattatgcttcgaag
aaaaacatcttcggcgatgaaatgtctacttccggttcgtctacggtctacatctatgcc
cccgacttctatgccgagaacatcacatttgccaacacagccggacgggtaggtcaagcc
gtagcctgctttgtagacggcgaccgtgcctatttcaagaattgccgtttcctgggcaat
caggatacgctctatacatacggaaaagagagccgccaatattatgagaattgctacatc
gaaggcacggtagatttcatcttcggctggagcaccgctttatttaaagactgcgagata
cgcagcctgggcaatggttatgtaacggctccctctaccgatcagggaaaaccttatggc
tatgtattctggaattgccggctgaccgccgatgccgaagcggacaaagtatatctttcc
cgtccgtggcgcccatacgcgcaagctgtctatatccaatgcgaattaggcaagcacatc
gtgcccgaaggctggaacaactggggcaaggcatcgaacgagaaaaccgctttctatgcc
gaataccaaagcaccggcgaaggcgccaatcctgccgcacgtgctccctacagccaccag
ttgaccgatatcagcaaatatcagcccgaaaaggttctggcaggcaatgacggatggaat
cccatccaaaacggaaatgccctgctgacgaatatcaaacgataa

DBGET integrated database retrieval system