KEGG   Bacteroides salanitronis: Bacsa_2706Help
Entry
Bacsa_2706        CDS       T01433                                 

Definition
Glutamate synthase (ferredoxin) (EC:1.4.7.1)
Orthology
K00265  
glutamate synthase (NADPH/NADH) large chain [EC:1.4.1.13 1.4.1.14]
Organism
bsa  Bacteroides salanitronis
Pathway
Alanine, aspartate and glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bsa01230]
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:bsa00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bsa00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3157730..3162247)
Genome map
AA seq 1505 aa AA seqDB search
MKEETFIRMESSAATDVQQTGLYDAAYEHDACGVGMIVDIHGNKSHELVDSALKVLENMK
HRGAEGADNKTGDGAGIMVQIPHEFILLQGIPVPEKGKYGTGLVFLPKDEQEQARILSIM
IEEIEREGLTLMHLRSVPVNSSILGQSAQETEPAIKQVFITGATDVENLERTLYIIRKKI
EKRIQHKDFYIVSLSSKNIIYKGMLSSVQVREYFQDLTQPYFTSGLAIVHSRFSTNTFPT
WSLAQPFRLLAHNGEINTIRGNRAWMEARESVLSTPTLGNVKDIRPIIQPGMSDSASLDN
VLEFFVMSGLSLPHAMAMLVPESFNDKNPISEDLKAFYEYHSILMEPWDGPAALLFSDGR
YAGGMLDRNGLRPARYLITKNDMMVVASEAGVISFEPETIKEKGRLQPGKILLIDTQEGK
IYYDGELKEQLASARPYRQWLSANRIELNTLKSGRKVENTVPDFERKLRAFGFTREDIER
TLTPMCTNGAEPTASMGNDTPLAVLSDMPQLLFNYFRQQFAQVTNPAIDPIREELVMSLT
EYIGAVGTNILLPSESHCKMVRLPHPILTNTELDILCNIRYKGFNTVKLPALFEVSKGKA
GLQEALTQLCKKAEQSVDDGVNYIILSDRGIDTEHAAIPSLLAVSAVHHHLISVQKRVQT
ALIVESGEVREVMHAALLLGYGASAFNPYMAFAVLDELVKRNEIQMNYETAEKNYIKAIC
KGLYKVMSKMGISTIRSYRGAKIFEAVGLSEELLKAYFGTGTSSVGGIRLEEIAKDYITF
HDNGFMPDEVEPLLPHIGQFSYRKDGEKHAWNPETISALQLATRTGSYAKFKEYTRKADE
KEHPIFLRDFFSFKRNPIPVEEVEPVEDIVKHFVTGAMSFGAISKEAHEAMTLAMNKLGT
RSNTGEGGEDSDRFHDTFDGISLCSKTKQVASGRFGVTAEYLVNAEEIQIKVAQGAKPGE
GGQLPGFKVNEVIARTRHSIPGISLISPPPHHDIYSIEDLAQLIFDLKNVNPKAQISVKL
VAESGIGTIAAGVAKAKADLIVISGAEGGTGASPASSMRYAGIPPEIGLSETQQTLVLNG
LRGQVRLQTDGQLKTGRDVISMALLGAEEFGFGTAALIVLGCVMMRKCHANTCPVGVATQ
NPELRDHFRGKYEYVVNFFRFLAQEVREYLAEMGFKHLDDIVGRTDLIEIKPRQMGSKAA
LLDFGRILHQVNNGSALHNVTIQKHDIDNVKDVAMLAAAREALESKKEVSLEYAIANTDR
AVGTMLSGAVALKYGEAGLPDQTINVKFKGSAGQSFGAFLTHGISFKLEGEANDYLGKGL
SGGHISVQPPVRSNFDAEKNTIVGNTLLYGATSGEVYINGRAGERFAVRNSGAIAVVEGV
GDHCCEYMTGGRVVVLGETGRNFAAGMSGGVAYVWDKNHNFDYFCNMEMVELSLLEDSTA
RKELHELVRQHYLYTGSQLARTMLDNWSRYVDEFIQVTPIEYKKVLAEEQMRKLQQKIAE
VQRDY
NT seq 4518 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggaaacttttatcagaatggagagcagcgcagctacagacgtacaacaaacg
ggattatacgatgctgcatacgagcacgatgcttgcggtgtgggaatgattgtagacatt
catggcaacaagtcgcacgaactggtggactcggcactgaaagtgctggagaatatgaaa
caccgcggggcggaaggtgccgacaacaagaccggagacggtgccggcatcatggtacag
attcctcatgagtttatcttgttgcaaggcataccggtacctgaaaaaggaaagtacggc
acagggttggttttcctgcccaaggacgagcaggaacaggcacgcatcctgagcatcatg
atagaggaaatagagcgtgaagggcttaccctgatgcacctgcggagcgtaccggtcaac
tcttccatcctggggcaaagcgcacaggagacggagccggctatcaagcaagtgttcatc
accggtgccacggacgtggaaaacctggaacgtaccttgtatatcatacgcaagaaaatc
gagaagcggatacaacacaaagacttctacatagtgtcattgtccagcaagaacattatt
tataaaggtatgctctcgtcggtgcaagtacgcgagtatttccaggacctgacacaacct
tacttcaccagcgggcttgccatcgtgcattcccgcttcagcaccaacaccttccccacg
tggagccttgcccagcctttccgcctcttggcgcataacggcgaaatcaataccatccgg
ggaaaccgtgcatggatggaagcccgggaaagtgtgctttctacgcctactctgggcaat
gtaaaggatatccgtcccatcatccagccgggcatgagcgatagcgcctcgctggacaat
gtattggagtttttcgtgatgtcgggcttgagcctgcctcatgccatggcgatgctggtg
cccgaatcgttcaacgacaagaatcctatcagcgaagacctgaaggcattctacgaatac
cattccatcctgatggaaccgtgggacgggcctgccgccctgcttttcagcgacggaagg
tatgccggaggtatgttggaccgtaacggcttgcgtccggcacgctacctcattacgaaa
aatgacatgatggtggtggcaagcgaggcgggtgtcatcagtttcgagccggagaccatc
aaggaaaaaggacgcctccagccgggaaagatattgcttatcgatacccaggaaggcaaa
atctattacgacggggaattgaaagaacagcttgcatcggcacgcccgtaccgccaatgg
ctttctgccaaccgcatcgaactgaacaccctgaagagcgggcggaaggtggaaaatacc
gtgcccgacttcgagcgtaagctccgtgccttcggtttcacgcgcgaggacatcgaacgc
acgctgacaccgatgtgcaccaacggtgccgaacctacggcatccatgggaaacgatacc
ccgctggcggtgctgagcgacatgcctcagttgctattcaactatttccgccagcagttc
gcacaagtgaccaaccctgctatcgacccgatacgcgaggaactggtgatgtcgctcacc
gaatacatcggggcggtgggcaccaacatcctcttgcccagcgaaagccattgcaagatg
gtacgccttccgcatcccatccttaccaataccgaactggacattctctgcaacatccgc
tataagggcttcaataccgtgaagcttcctgcgctcttcgaagtcagcaaagggaaggca
ggattgcaggaagccctgacccagttgtgcaagaaagccgaacaatcggtagatgatggc
gtaaactatatcatcctgtcggatagaggcatcgatacggaacacgccgccatcccgtcc
ctgcttgccgtaagtgccgtgcaccatcaccttatcagcgtgcagaaacgtgtacagacc
gcgctgattgtagaaagcggagaggtgcgtgaggtgatgcatgccgccctgcttctggga
tacggggcaagtgccttcaatccgtacatggcatttgcggtattggacgaactggtgaaa
cgcaacgaaatccaaatgaactatgaaaccgcggaaaagaactacatcaaggccatctgc
aagggattgtataaggtgatgagcaagatgggcatcagtaccatccgttcgtaccgcggc
gccaagatattcgaagccgtcgggctgagtgaagaattgctgaaggcttatttcggcacc
ggaacgtcttcggtgggaggcatccggctggaagagatagccaaagactatatcacgttc
cacgacaacgggttcatgccggatgaagtagagcctttattgccgcatatcggacagttc
tcttaccggaaagacggagagaaacatgcctggaaccctgaaaccatcagtgcccttcag
ctcgccacacgcacgggaagctatgccaagttcaaggaatacacccgcaaggcggacgag
aaagagcatcccattttcttgcgcgacttcttctccttcaagcgcaaccccattccggta
gaagaagtggagccggtagaggatatagtgaaacatttcgtgacgggagccatgtcgttc
ggcgccatcagcaaggaagcccacgaggcaatgacgcttgcgatgaacaagctgggcaca
cggagcaatacgggcgaaggaggcgaggattcggaccgctttcacgacacgttcgacggc
atctcgctctgtagcaagaccaagcaggtggcatcgggacgtttcggagtgaccgccgaa
tacctggtgaatgccgaagagatacaaatcaaggtggcgcagggagccaagcccggtgaa
ggcggacagcttccgggcttcaaggtgaacgaggtcatcgcccgtacgcgccattccatt
ccgggcatctcattgatttcacctccgccccatcacgatatctactccatcgaggatttg
gctcagctcatctttgacttgaagaacgtgaatccgaaagcccaaatcagcgtgaaactg
gtggcagagagcggtatcggaaccatagccgccggcgtagcgaaggcgaaagccgacctg
attgtgatttcgggagccgaaggaggcacaggggcttcgcccgcctcatccatgcgctat
gcgggcatcccgcccgaaatagggttgagcgagactcagcagacattggtgctgaacggt
ttgcgcggacaggtacgcctgcagaccgacggacaactgaagaccggacgggatgttatc
agcatggcattgctgggagccgaagaattcggtttcggtacggcggcactgattgtcttg
ggatgtgtgatgatgcgcaagtgccacgccaacacgtgcccggtgggcgtagctacccag
aatccggagttacgcgaccatttccgcgggaaatacgaatatgtagtcaatttcttccgc
ttcctggcacaggaggtgcgcgagtatcttgccgaaatgggcttcaagcacctcgatgac
attgtaggacgtaccgacctcatcgaaatcaagccccgccaaatgggaagcaaggcagcc
ctgctcgacttcggccgcatcctgcatcaggtgaacaacgggtcggcactgcacaacgtc
actatacaaaagcacgacatcgacaacgtgaaagacgtagcgatgcttgccgctgcccgt
gaggcgttggagagcaagaaagaagtatcgctggaatatgccattgccaataccgaccgt
gcagtaggcacgatgctctcgggagccgtagcgttgaagtatggtgaggcaggcttgccc
gaccagaccatcaacgtgaagttcaaaggctcggcaggacagagtttcggcgctttcctg
acccacggcatcagcttcaagctggaaggggaagccaacgattatttgggcaagggcttg
agcggaggccacatttcagtacagcctcctgtacggagcaatttcgatgccgagaagaat
accatcgtgggcaataccctgctctatggtgctacaagcggcgaagtgtatattaacgga
cgtgccggagagcggtttgcggtgcgcaattcgggtgccatagccgtagtagaaggcgta
ggcgaccattgttgcgaatacatgaccggcggacgggtggtcgtattgggagaaaccgga
cgtaactttgccgccggtatgagcggaggcgtggcttacgtgtgggacaagaaccataac
ttcgactatttctgcaacatggaaatggtggaactctccttgctggaagactccaccgcc
cgcaaggaactgcacgaactggtacgccagcattacctctacacggggtcgcaattggca
cgcaccatgctcgacaactggagccgttacgtagacgagttcattcaggtgacgccgatt
gaatacaaaaaggtgcttgccgaagagcagatgcgcaaactccagcaaaagattgccgaa
gtgcaaagagactactaa

DBGET integrated database retrieval system