KEGG   Bacteroides salanitronis: Bacsa_2706Help
Entry
Bacsa_2706        CDS       T01433                                 

Definition
Glutamate synthase (ferredoxin) (EC:1.4.7.1)
Orthology
K00265  
glutamate synthase (NADPH/NADH) large chain [EC:1.4.1.13 1.4.1.14]
Organism
bsa  Bacteroides salanitronis
Pathway
Alanine, aspartate and glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bacsa_2706
  Energy metabolism
   00910 Nitrogen metabolism
    Bacsa_2706
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bacsa_2706
Enzymes [BR:bsa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     Bacsa_2706
    1.4.1.14  glutamate synthase (NADH)
     Bacsa_2706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3157730..3162247)
Genome map
AA seq 1505 aa AA seqDB search
MKEETFIRMESSAATDVQQTGLYDAAYEHDACGVGMIVDIHGNKSHELVDSALKVLENMK
HRGAEGADNKTGDGAGIMVQIPHEFILLQGIPVPEKGKYGTGLVFLPKDEQEQARILSIM
IEEIEREGLTLMHLRSVPVNSSILGQSAQETEPAIKQVFITGATDVENLERTLYIIRKKI
EKRIQHKDFYIVSLSSKNIIYKGMLSSVQVREYFQDLTQPYFTSGLAIVHSRFSTNTFPT
WSLAQPFRLLAHNGEINTIRGNRAWMEARESVLSTPTLGNVKDIRPIIQPGMSDSASLDN
VLEFFVMSGLSLPHAMAMLVPESFNDKNPISEDLKAFYEYHSILMEPWDGPAALLFSDGR
YAGGMLDRNGLRPARYLITKNDMMVVASEAGVISFEPETIKEKGRLQPGKILLIDTQEGK
IYYDGELKEQLASARPYRQWLSANRIELNTLKSGRKVENTVPDFERKLRAFGFTREDIER
TLTPMCTNGAEPTASMGNDTPLAVLSDMPQLLFNYFRQQFAQVTNPAIDPIREELVMSLT
EYIGAVGTNILLPSESHCKMVRLPHPILTNTELDILCNIRYKGFNTVKLPALFEVSKGKA
GLQEALTQLCKKAEQSVDDGVNYIILSDRGIDTEHAAIPSLLAVSAVHHHLISVQKRVQT
ALIVESGEVREVMHAALLLGYGASAFNPYMAFAVLDELVKRNEIQMNYETAEKNYIKAIC
KGLYKVMSKMGISTIRSYRGAKIFEAVGLSEELLKAYFGTGTSSVGGIRLEEIAKDYITF
HDNGFMPDEVEPLLPHIGQFSYRKDGEKHAWNPETISALQLATRTGSYAKFKEYTRKADE
KEHPIFLRDFFSFKRNPIPVEEVEPVEDIVKHFVTGAMSFGAISKEAHEAMTLAMNKLGT
RSNTGEGGEDSDRFHDTFDGISLCSKTKQVASGRFGVTAEYLVNAEEIQIKVAQGAKPGE
GGQLPGFKVNEVIARTRHSIPGISLISPPPHHDIYSIEDLAQLIFDLKNVNPKAQISVKL
VAESGIGTIAAGVAKAKADLIVISGAEGGTGASPASSMRYAGIPPEIGLSETQQTLVLNG
LRGQVRLQTDGQLKTGRDVISMALLGAEEFGFGTAALIVLGCVMMRKCHANTCPVGVATQ
NPELRDHFRGKYEYVVNFFRFLAQEVREYLAEMGFKHLDDIVGRTDLIEIKPRQMGSKAA
LLDFGRILHQVNNGSALHNVTIQKHDIDNVKDVAMLAAAREALESKKEVSLEYAIANTDR
AVGTMLSGAVALKYGEAGLPDQTINVKFKGSAGQSFGAFLTHGISFKLEGEANDYLGKGL
SGGHISVQPPVRSNFDAEKNTIVGNTLLYGATSGEVYINGRAGERFAVRNSGAIAVVEGV
GDHCCEYMTGGRVVVLGETGRNFAAGMSGGVAYVWDKNHNFDYFCNMEMVELSLLEDSTA
RKELHELVRQHYLYTGSQLARTMLDNWSRYVDEFIQVTPIEYKKVLAEEQMRKLQQKIAE
VQRDY
NT seq 4518 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggaaacttttatcagaatggagagcagcgcagctacagacgtacaacaaacg
ggattatacgatgctgcatacgagcacgatgcttgcggtgtgggaatgattgtagacatt
catggcaacaagtcgcacgaactggtggactcggcactgaaagtgctggagaatatgaaa
caccgcggggcggaaggtgccgacaacaagaccggagacggtgccggcatcatggtacag
attcctcatgagtttatcttgttgcaaggcataccggtacctgaaaaaggaaagtacggc
acagggttggttttcctgcccaaggacgagcaggaacaggcacgcatcctgagcatcatg
atagaggaaatagagcgtgaagggcttaccctgatgcacctgcggagcgtaccggtcaac
tcttccatcctggggcaaagcgcacaggagacggagccggctatcaagcaagtgttcatc
accggtgccacggacgtggaaaacctggaacgtaccttgtatatcatacgcaagaaaatc
gagaagcggatacaacacaaagacttctacatagtgtcattgtccagcaagaacattatt
tataaaggtatgctctcgtcggtgcaagtacgcgagtatttccaggacctgacacaacct
tacttcaccagcgggcttgccatcgtgcattcccgcttcagcaccaacaccttccccacg
tggagccttgcccagcctttccgcctcttggcgcataacggcgaaatcaataccatccgg
ggaaaccgtgcatggatggaagcccgggaaagtgtgctttctacgcctactctgggcaat
gtaaaggatatccgtcccatcatccagccgggcatgagcgatagcgcctcgctggacaat
gtattggagtttttcgtgatgtcgggcttgagcctgcctcatgccatggcgatgctggtg
cccgaatcgttcaacgacaagaatcctatcagcgaagacctgaaggcattctacgaatac
cattccatcctgatggaaccgtgggacgggcctgccgccctgcttttcagcgacggaagg
tatgccggaggtatgttggaccgtaacggcttgcgtccggcacgctacctcattacgaaa
aatgacatgatggtggtggcaagcgaggcgggtgtcatcagtttcgagccggagaccatc
aaggaaaaaggacgcctccagccgggaaagatattgcttatcgatacccaggaaggcaaa
atctattacgacggggaattgaaagaacagcttgcatcggcacgcccgtaccgccaatgg
ctttctgccaaccgcatcgaactgaacaccctgaagagcgggcggaaggtggaaaatacc
gtgcccgacttcgagcgtaagctccgtgccttcggtttcacgcgcgaggacatcgaacgc
acgctgacaccgatgtgcaccaacggtgccgaacctacggcatccatgggaaacgatacc
ccgctggcggtgctgagcgacatgcctcagttgctattcaactatttccgccagcagttc
gcacaagtgaccaaccctgctatcgacccgatacgcgaggaactggtgatgtcgctcacc
gaatacatcggggcggtgggcaccaacatcctcttgcccagcgaaagccattgcaagatg
gtacgccttccgcatcccatccttaccaataccgaactggacattctctgcaacatccgc
tataagggcttcaataccgtgaagcttcctgcgctcttcgaagtcagcaaagggaaggca
ggattgcaggaagccctgacccagttgtgcaagaaagccgaacaatcggtagatgatggc
gtaaactatatcatcctgtcggatagaggcatcgatacggaacacgccgccatcccgtcc
ctgcttgccgtaagtgccgtgcaccatcaccttatcagcgtgcagaaacgtgtacagacc
gcgctgattgtagaaagcggagaggtgcgtgaggtgatgcatgccgccctgcttctggga
tacggggcaagtgccttcaatccgtacatggcatttgcggtattggacgaactggtgaaa
cgcaacgaaatccaaatgaactatgaaaccgcggaaaagaactacatcaaggccatctgc
aagggattgtataaggtgatgagcaagatgggcatcagtaccatccgttcgtaccgcggc
gccaagatattcgaagccgtcgggctgagtgaagaattgctgaaggcttatttcggcacc
ggaacgtcttcggtgggaggcatccggctggaagagatagccaaagactatatcacgttc
cacgacaacgggttcatgccggatgaagtagagcctttattgccgcatatcggacagttc
tcttaccggaaagacggagagaaacatgcctggaaccctgaaaccatcagtgcccttcag
ctcgccacacgcacgggaagctatgccaagttcaaggaatacacccgcaaggcggacgag
aaagagcatcccattttcttgcgcgacttcttctccttcaagcgcaaccccattccggta
gaagaagtggagccggtagaggatatagtgaaacatttcgtgacgggagccatgtcgttc
ggcgccatcagcaaggaagcccacgaggcaatgacgcttgcgatgaacaagctgggcaca
cggagcaatacgggcgaaggaggcgaggattcggaccgctttcacgacacgttcgacggc
atctcgctctgtagcaagaccaagcaggtggcatcgggacgtttcggagtgaccgccgaa
tacctggtgaatgccgaagagatacaaatcaaggtggcgcagggagccaagcccggtgaa
ggcggacagcttccgggcttcaaggtgaacgaggtcatcgcccgtacgcgccattccatt
ccgggcatctcattgatttcacctccgccccatcacgatatctactccatcgaggatttg
gctcagctcatctttgacttgaagaacgtgaatccgaaagcccaaatcagcgtgaaactg
gtggcagagagcggtatcggaaccatagccgccggcgtagcgaaggcgaaagccgacctg
attgtgatttcgggagccgaaggaggcacaggggcttcgcccgcctcatccatgcgctat
gcgggcatcccgcccgaaatagggttgagcgagactcagcagacattggtgctgaacggt
ttgcgcggacaggtacgcctgcagaccgacggacaactgaagaccggacgggatgttatc
agcatggcattgctgggagccgaagaattcggtttcggtacggcggcactgattgtcttg
ggatgtgtgatgatgcgcaagtgccacgccaacacgtgcccggtgggcgtagctacccag
aatccggagttacgcgaccatttccgcgggaaatacgaatatgtagtcaatttcttccgc
ttcctggcacaggaggtgcgcgagtatcttgccgaaatgggcttcaagcacctcgatgac
attgtaggacgtaccgacctcatcgaaatcaagccccgccaaatgggaagcaaggcagcc
ctgctcgacttcggccgcatcctgcatcaggtgaacaacgggtcggcactgcacaacgtc
actatacaaaagcacgacatcgacaacgtgaaagacgtagcgatgcttgccgctgcccgt
gaggcgttggagagcaagaaagaagtatcgctggaatatgccattgccaataccgaccgt
gcagtaggcacgatgctctcgggagccgtagcgttgaagtatggtgaggcaggcttgccc
gaccagaccatcaacgtgaagttcaaaggctcggcaggacagagtttcggcgctttcctg
acccacggcatcagcttcaagctggaaggggaagccaacgattatttgggcaagggcttg
agcggaggccacatttcagtacagcctcctgtacggagcaatttcgatgccgagaagaat
accatcgtgggcaataccctgctctatggtgctacaagcggcgaagtgtatattaacgga
cgtgccggagagcggtttgcggtgcgcaattcgggtgccatagccgtagtagaaggcgta
ggcgaccattgttgcgaatacatgaccggcggacgggtggtcgtattgggagaaaccgga
cgtaactttgccgccggtatgagcggaggcgtggcttacgtgtgggacaagaaccataac
ttcgactatttctgcaacatggaaatggtggaactctccttgctggaagactccaccgcc
cgcaaggaactgcacgaactggtacgccagcattacctctacacggggtcgcaattggca
cgcaccatgctcgacaactggagccgttacgtagacgagttcattcaggtgacgccgatt
gaatacaaaaaggtgcttgccgaagagcagatgcgcaaactccagcaaaagattgccgaa
gtgcaaagagactactaa

DBGET integrated database retrieval system