KEGG   Bacteroides salanitronis: Bacsa_2950Help
Entry
Bacsa_2950        CDS       T01433                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bsa  Bacteroides salanitronis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bacsa_2950
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bacsa_2950
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bacsa_2950
Enzymes [BR:bsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bacsa_2950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3476563..3477345)
Genome map
AA seq 260 aa AA seqDB search
MNRINQLFEQKKHDILSIYFCAGCPTPDNTADVIRTLEAQGVDMIEIGIPFSDPMADGPV
IQDAATRALRGGMTLRRLFAQLEGIRRNVRIPLILMGYLNPIMQYGFENFCQSCQACGID
GMIIPDLPFKDYMEEYRPIAERYDLRIIMLITPETSEERIREIDRHTEGFIYMVSSAAIT
GAQRDFNEQKQAYFRRIEAMNLRNPRMIGFGISNRQTYEAASAHAAGCIIGSKFVTLLNE
AQGDALKAVTRIKEAIFNRQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtatcaatcaactattcgaacaaaagaaacacgacatcctctccatctatttc
tgtgcaggatgtcccacacccgacaacaccgccgatgtcatccgcaccctcgaagcgcaa
ggtgtggatatgatagaaatcggcatccctttcagcgacccgatggcagacggccccgtc
atccaagacgccgctacccgagccctgcgtggcggaatgaccctacgccgccttttcgcc
caattggaaggcatccgccgcaacgtacgcatccccctcatcctgatgggctacctcaac
cccatcatgcaatacggattcgagaacttttgccaaagctgccaggcatgcggcatagac
ggaatgattatccccgaccttcctttcaaagactacatggaagaataccgtcccatagcc
gaacgctatgacctgcgcatcattatgctgattacccccgaaaccagcgaagaacgcatc
cgcgaaatcgaccgccataccgaaggttttatctatatggtatcttctgccgccatcacc
ggcgcgcaacgcgacttcaacgagcagaagcaggcatacttccgccgcatcgaggcgatg
aacctgcgcaacccacggatgataggcttcggcatctcaaaccgccaaacctacgaagcc
gcctctgcccacgccgccggatgcatcatcggaagcaagttcgtcaccttgctcaatgaa
gcgcaaggcgatgccctgaaagcggttacaaggatcaaagaggcgattttcaatagacaa
tga

DBGET integrated database retrieval system