KEGG   Bacteroides salanitronis: Bacsa_2956Help
Entry
Bacsa_2956        CDS       T01433                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bsa  Bacteroides salanitronis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bacsa_2956
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bacsa_2956
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bacsa_2956
Enzymes [BR:bsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bacsa_2956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3482445..3483638)
Genome map
AA seq 397 aa AA seqDB search
MNRKKYQVDSNGYYGNFGGAYIPEILHRCVTELKDAYLRVLDSDDFKQEFAQLLRDYVGR
PSPLYLANRLSEKYGCKIYLKREDLNHTGAHKINNAIGQVLLARRMGKKRIIAETGAGQH
GVATATVCALMNMECVVYMGETDVARQHINVEKMKMLGAEVRPVTSGNKTLKDATNEAIR
DWCCHPEDTYYVIGSTVGPHPYPDMVARLQSVISEEIKKQLMEHEGRDYPDYLIACVGGG
SNAAGTVYHYLNNDKVKIVLAEAGGKGIHSGYSAATIQLGRLGIIHGAKTLVMQDEDGQI
LEPYSVSAGLDYPGIGPLHANLATQHRATVLAINDDEAIRAAYELTRLEGIIPALESAHA
LGALEKVSFRPEDIVVLTVSGRGDKDMETYLNNVQMC
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaatcggaaaaagtatcaagtagactcaaacgggtattatggaaatttcggcggagca
tacatccccgaaattcttcaccggtgcgtgaccgaactgaaagacgcgtacctacgggta
ttggatagcgatgatttcaagcaagagttcgcccaattgttgcgcgactacgtgggacgt
ccctctcccctgtatcttgccaaccggctttcggagaaatacggatgcaagatttacctg
aaacgggaggacctgaaccatacaggcgcacacaagataaacaacgccatcgggcaagtg
ctgctggcacggcgaatgggaaagaaacgcatcatcgccgaaaccggagccggacagcac
ggagtagcgaccgctacggtctgcgcactgatgaacatggaatgcgtggtgtatatgggc
gaaaccgatgtggcacgccagcacatcaacgtggaaaaaatgaagatgctgggagccgaa
gtgcgcccggtcacctcgggaaacaaaaccctgaaggatgccaccaatgaagccatacgc
gactggtgctgccaccccgaagacacatactacgtgataggttctaccgtagggcctcat
ccttaccccgacatggtggcacgcctgcaatcggtcatcagcgaagaaatcaaaaaacaa
ctgatggagcacgagggacgtgattatcccgactatctgatagcgtgcgtgggcggagga
agcaacgccgccggcaccgtctatcattacctgaacaacgacaaggtgaaaatcgtactc
gccgaagcaggcggaaagggcatccattcgggatactctgccgccaccatccaactggga
cggctgggcatcatacacggagcgaaaaccctcgtgatgcaagacgaagacggacaaatc
ctggaaccctactcggtatcggcagggctggactatccgggtatcggtcccctgcacgcc
aaccttgccacacaacaccgtgccacggtgctcgccatcaacgatgacgaagccatccgt
gccgcctacgaactgacccgtctggaaggcatcatccccgcactggaatcggcacacgca
ttgggcgcactggagaaggtcagtttccgccccgaagacatcgtggtgctcaccgtatcg
ggacgaggggacaaggacatggaaacgtatttgaataatgtgcaaatgtgctaa

DBGET integrated database retrieval system