KEGG   Bacteroides salanitronis: Bacsa_3062Help
Entry
Bacsa_3062        CDS       T01433                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bsa  Bacteroides salanitronis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bacsa_3062
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bacsa_3062
   00052 Galactose metabolism
    Bacsa_3062
   00500 Starch and sucrose metabolism
    Bacsa_3062
   00520 Amino sugar and nucleotide sugar metabolism
    Bacsa_3062
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bacsa_3062
   00524 Butirosin and neomycin biosynthesis
    Bacsa_3062
Enzymes [BR:bsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Bacsa_3062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3637690..3638664
Genome map
AA seq 324 aa AA seqDB search
MAENIEKPYVVGMDIGGTNTVFGIVDSRGNVLASDSIKTQQHEDVNEYVEAVCAKLVPMI
EQFGGPSKIKGMGVGAPNGNYYSGTIEFAPNLPWKGVIPLAAMFEERLGVPTALTNDANA
AAIGEMTYGAARGMKDFIMITLGTGVGSGIVINGQLVYGHDGFAGELGHVMVEKDGRICG
CGRKGCLETYCSATGVARTAREFLVARSEPSLLRNVPAEEIQSKDVYDAAVKGDKLAQDI
FQFTGDMLGRALANFIAFSSPEAIILFGGLAKSGDYIMKPIQKAMEDNVLNIYKGKTKLL
LSQLKDADAAVLGASALGWEVKES
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaacatagaaaagccctatgtagtgggtatggacatcggcggaacgaatacg
gtgttcggtattgtagattcacgcggaaacgtattggcatccgactctattaagacacag
caacatgaagacgtgaacgaatatgtagaagcagtatgtgccaaactggttccgatgatt
gaacaattcggaggtccgagcaagattaaaggcatgggcgtaggtgctcctaacggaaat
tattatagcggcactatcgaatttgctcctaatttgccttggaaaggcgttattcctttg
gcagctatgttcgaggaacgtttgggcgtccctaccgcactgactaatgatgccaatgcg
gcggctatcggtgaaatgacctatggagcagcccgcggcatgaaagactttatcatgatt
accctcggcacaggtgtaggaagcggtatcgttatcaacggccagctggtttacggtcac
gacggattcgcaggtgagttgggacacgttatggtagaaaaggacgggcgtatctgcgga
tgcggacgcaagggctgtctggaaacttattgctcggctacgggtgtggcacgtaccgcg
cgcgaattccttgtggcacgttccgaacccagcttgttacgcaatgttccggcagaagaa
atccagtcgaaagacgtgtatgacgcggcggttaagggagacaagctcgctcaggatatc
ttccagtttacgggcgacatgttgggacgcgcacttgccaacttcatcgctttctccagc
cccgaagcgattatcctgttcggaggcttggctaaatcaggcgactatatcatgaagcct
atccaaaaagcgatggaggataatgtattgaatatctataaaggaaagaccaagctgctc
ctctctcaattgaaagatgccgatgccgcggtattaggcgccagcgcattgggttgggaa
gtaaaggaaagttga

DBGET integrated database retrieval system