KEGG   Brevundimonas subvibrioides: Bresu_0143Help
Entry
Bresu_0143        CDS       T01291                                 

Definition
nicotinate (nicotinamide) nucleotide adenylyltransferase (EC:2.7.7.18)
Orthology
K00969  
nicotinate-nucleotide adenylyltransferase [EC:2.7.7.18]
Organism
bsb  Brevundimonas subvibrioides
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Module
NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:bsb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Bresu_0143
Enzymes [BR:bsb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     Bresu_0143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(130693..131346)
Genome map
AA seq 217 aa AA seqDB search
MSFFHAGPAPKASGPRPGALRDGLDLRPGMRVGLFGGSFNPAHDGHAHVAETAMRRLDLD
RVVWLVSPQNPLKDARQTAPLADRLASARAIAPGPRMIVSDFETRAGTRWTVDTLRALKA
RHPGVRFVWLMGSDNLESFHRWRGWTDIMRMMPVAVVARPGSLLESRSAPAARRFAGHRV
ASEEARMLPLMGAPAWTYLTAPLNPSSSTALRAKAQR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
ttgtccttctttcatgccggtcccgcgcccaaggccagcggtcccagacccggagccctg
agggacgggctggacctccgccccggcatgcgggtcgggctgttcggcgggtcgttcaat
ccggcgcacgacggccacgcccatgtggcggagaccgcgatgcggcggctggatctcgat
cgcgtcgtctggctggtctcgccccagaatccgctgaaggatgcccgccagaccgcgccc
ctggccgaccgcctggcctccgcgcgggccatcgctccgggcccgcgcatgatcgtctcg
gacttcgagacccgcgcgggcacccgctggacggtcgataccctgagagcgctgaaggcg
cggcatccgggggtgcgcttcgtctggctgatggggtccgacaatctggagagctttcat
cgctggcgcggctggaccgacatcatgcgcatgatgcccgtggccgtcgtggcccggccc
ggatccctgctggagagccgctcggccccggctgcccgccgcttcgccggccaccgcgtc
gcgtcggaagaggcgcggatgctgcccctgatgggcgccccggcctggacctatctgacc
gcccccctgaacccgagttcgtccacagcgctgcgggccaaagcccaaaggtga

DBGET integrated database retrieval system