KEGG   Brevundimonas subvibrioides: Bresu_0273Help
Entry
Bresu_0273        CDS       T01291                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bsb  Brevundimonas subvibrioides
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bresu_0273
   00030 Pentose phosphate pathway
    Bresu_0273
   00051 Fructose and mannose metabolism
    Bresu_0273
   00052 Galactose metabolism
    Bresu_0273
   00500 Starch and sucrose metabolism
    Bresu_0273
   00520 Amino sugar and nucleotide sugar metabolism
    Bresu_0273
  Nucleotide metabolism
   00230 Purine metabolism
    Bresu_0273
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bresu_0273
Enzymes [BR:bsb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Bresu_0273
    5.4.2.8  phosphomannomutase
     Bresu_0273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
252739..254238
Genome map
AA seq 499 aa AA seqDB search
MSKPRQDLVPNTFEYETTALVKPTGFREYDARWILEKEINLLGIQALGLALATYVHENDI
QPRIVVGHDFRSYSISVKQALILGLLEGGMEVLDIGLALSPMAYFGQFALNAPCVAMVTA
SHNENGWTGVKMGTNPPVTFGPEEIGRLKEIVLSGTGVARPGGRLERVENFRELYLQEVV
GSIKLSRPLKVVCACGNGTAGAFAPEALRRMGAEVIEMDTDLDYTFPKYNPNPEDHAMLM
QMAQRVRETGADLALGFDGDGDRCGVVDNTGEEIFADKIGLLLARDLSALHPNATFVVDV
KSTGLYKTDEVLAANGATTVYWKTGHSYIKRKTAELGALAGFEKSGHFFLANPIGRGYDD
GLVAAAAVLQMMDRNPGKTLFELKSSLPDAWTSLTMSPHCDDEIKYDVLAKIVAEYEKLG
AEGGSILGRKIVEVITVNGARVHLEDGSWVLVRASSNKPELVVVVESMRSEDDMRALFQQ
EVKPRLAAHPEVGTYNQEI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagccccgccaggacctggtcccgaacacgttcgagtacgagaccaccgccctg
gtgaagccgacggggttccgcgagtacgacgcccgctggatcctggagaaggagatcaac
ctcttgggcatccaggccctggggctggccctggcgacctatgtccacgaaaacgacatc
cagccgcgcatcgtcgtcggccatgacttccggtcctattccatcagcgtcaaacaggcc
ctgatcctgggcctgctggaaggcgggatggaggtgctggacatcggcctggccctgtcg
ccgatggcctatttcggccagttcgccctgaacgccccctgcgtggccatggtcacggcc
agccacaacgagaacggctggaccggggtcaagatgggcaccaacccgcccgtcaccttc
ggccccgaggagatcggccggctgaaggagatcgtgctgtccggaaccggcgtcgcccgg
cccggcggacggctggagcgggtcgagaacttccgcgaactgtaccttcaggaggtggtc
ggatcgatcaagctcagccggccgctgaaggtcgtctgcgcctgcggcaacggcaccgcc
ggagccttcgcgcccgaggccctgcgccgaatgggagccgaggtgatcgagatggacacc
gacctcgactacaccttccccaaatacaatccgaacccggaagaccacgccatgctgatg
cagatggcgcagcgggtgcgcgagacgggcgccgacctggccctgggcttcgacggcgac
ggcgaccgctgcggcgtggtcgacaacaccggcgaggagatcttcgccgacaagatcggc
ctgctgctggcccgcgacctgtcggccctgcaccccaatgcgaccttcgtcgtcgatgtg
aaatcgaccggactgtacaagaccgacgaggtcctggcggccaacggcgcgaccaccgtc
tactggaagaccggccactcctacatcaagcgcaagaccgccgaactgggggcgctggcc
gggttcgagaagtcgggccacttcttcctggcgaacccgatcgggcgcggatacgacgac
ggcctggtcgccgccgccgccgtcctgcagatgatggacaggaaccccggcaagaccctg
ttcgagctgaagtcgtcgctgccggacgcctggacgtccctgaccatgtcgccccactgc
gacgacgagatcaaatacgacgtgctcgccaagatcgtcgccgagtacgagaaactgggg
gccgagggtggctcgatcctcggccgcaagatcgtcgaggtcatcaccgtcaacggcgcg
cgggtgcacctggaagacgggtcgtgggtgctggtgcgcgcctcctccaacaagccggaa
ctggtcgtcgtggtcgaatccatgcggtccgaggacgacatgcgcgccctgttccagcag
gaggtcaaaccccgtctggccgcccaccccgaggtcgggacctacaaccaggaaatctga

DBGET integrated database retrieval system