KEGG   Brevundimonas subvibrioides: Bresu_0470Help
Entry
Bresu_0470        CDS       T01291                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bsb  Brevundimonas subvibrioides
Pathway
bsb00020  Citrate cycle (TCA cycle)
bsb00640  Propanoate metabolism
bsb00660  C5-Branched dibasic acid metabolism
bsb01100  Metabolic pathways
bsb01110  Biosynthesis of secondary metabolites
bsb01120  Microbial metabolism in diverse environments
bsb01130  Biosynthesis of antibiotics
bsb01200  Carbon metabolism
Module
bsb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bresu_0470
   00640 Propanoate metabolism
    Bresu_0470
   00660 C5-Branched dibasic acid metabolism
    Bresu_0470
Enzymes [BR:bsb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Bresu_0470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 FimP GARS_A
Motif
Other DBs
NCBI-ProteinID: ADK99784
UniProt: D9QKF9
Position
complement(466333..467523)
Genome map
AA seq 396 aa AA seqDB search
MNIHEYQAKQVLKGFGAPVAAGVAVTSVDQVEAAAKSLPGPLYVVKSQIHAGGRGKGKFK
ELGPDAKGGVRLAFSVEEAVAHAKEMLGNTLVTAQTGDAGKQVNRLYIEDGADIERELYC
SLLVDRAHGRIAYVVSTEGGMDIEAVAHDTPDKIQTIVIDPETGVTEADVAAINAAYGLT
GAAAEDGKSLFPILYKAFVETDMDMLEVNPLIVMKDGHLRVLDAKVSFDGNALFRHEDIK
TLRDETEEDAKEIEASKWDLAYVSLDGNIGCMVNGAGLAMATMDIIKLYGKEPANFCDVG
GGAGKDKVAAAFKIITADPNVQGILVNIFGGIMKCDVIAEGVVAAVKEVGLKVPLVVRLE
GTNAELGKKILNESGLAITAADDLDDAAQKIVAAVG
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaataccaggccaaacaggtcctgaagggctttggcgcaccggtcgcc
gccggcgtcgccgtgacctcggtcgatcaggtcgaggccgctgccaagtccctgcccggc
ccgctctatgtcgtgaagtcgcagatccacgccggcggacgcggcaagggcaagttcaag
gaactgggccccgacgccaagggcggcgtgcgcctggccttctcggtcgaggaagccgtg
gcccatgcgaaagagatgctgggcaacaccctggtcaccgcccagaccggtgacgcgggc
aagcaggtcaaccgcctgtacatcgaggacggcgccgacatcgagcgcgagctgtactgc
tcgctgctggtcgaccgtgcccacggccgcatcgcctatgtcgtctcgaccgagggcggc
atggacatcgaggccgtcgcccacgacacgcccgacaagatccagaccatcgtcatcgac
cccgagacgggcgtgaccgaggccgacgtggccgccatcaacgccgcctatggcctgacc
ggcgcggccgccgaggacggcaagtcgctgttccccatcctgtacaaggcctttgtcgag
accgacatggacatgctggaggtgaaccccctcatcgtcatgaaggacggccacctgcgg
gtgctggacgccaaggtcagcttcgacggcaacgccctgttccgccacgaggacatcaag
accctgcgcgacgagaccgaggaagacgccaaggagatcgaggcgtccaaatgggacctc
gcctatgtctcgctggacggcaacatcggctgcatggtcaacggcgccggcctggccatg
gcgacgatggacatcatcaagctgtacggcaaggaacccgccaacttctgcgacgtcggc
ggcggcgccggcaaggacaaggtcgcggcggccttcaagatcatcaccgccgacccgaac
gtccagggcatcctggtcaacatcttcggcggcatcatgaagtgcgacgtgatcgccgag
ggcgtggtcgcggccgtgaaggaagtgggcctgaaggtgccgctggtcgtccgtctggaa
ggcaccaatgccgaactgggcaagaagatcctgaacgagtcgggcctggccatcacggcc
gccgacgacctcgacgacgccgcccagaagatcgtcgcggcggtcggctga

DBGET integrated database retrieval system