KEGG   Brevundimonas subvibrioides: Bresu_0486Help
Entry
Bresu_0486        CDS       T01291                                 

Definition
nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bsb  Brevundimonas subvibrioides
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bresu_0486
   00052 Galactose metabolism
    Bresu_0486
   00500 Starch and sucrose metabolism
    Bresu_0486
   00520 Amino sugar and nucleotide sugar metabolism
    Bresu_0486
Enzymes [BR:bsb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bresu_0486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
482887..483765
Genome map
AA seq 292 aa AA seqDB search
MTTSPSRVRKAVLPVAGLGTRVLPAAKTTPKNMLNVFDRPILSHIVEEARASGIEHIIFV
VGRGQGSIEDYFDHAYEMEAILKAKGKDDILAQVVADLPKPGEMSYVRQMAPLGLGHAVF
CARDLIGDEPFAVMLPDMLMMADTPALKQAIDAHEKTGGNVVVVEQAPEGETHKYGIVAL
DGQDGRLNRMTGMVEKPPLGTEPSNLFISGRYVLTPDIFPLLADQQTGAGGEIQLTDAMA
RLMKVKDFHALEYEGATYDCGDPVGLLRANVAYALEHASLSEAARAAVTGLL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaccacatcgccgtctcgcgtccgcaaggccgtcctgcccgtcgccgggctgggcacc
cgggtcctgcccgccgccaagaccacgcccaagaacatgctgaacgtgttcgaccggccg
atcctgtcgcacatcgtcgaggaggcgcgcgcctcgggcatcgaacacatcatcttcgtc
gtcggacgcggccagggctcgatcgaggactatttcgaccacgcctacgagatggaggcg
atcctcaaggccaagggcaaggacgacatcctggcccaggtggtggccgacctgccgaag
cccggcgagatgagctacgtgcgccagatggctccgctgggtctgggtcacgccgtcttc
tgcgcccgcgacctgatcggcgacgagcctttcgcggtcatgctgcccgacatgctgatg
atggccgacacccccgcgctgaagcaggccatcgacgcccatgaaaagaccggcggcaat
gtcgtcgtggtcgaacaggccccggaaggcgagacccacaaatacggcatcgtcgcgctc
gacggtcaggacggtcggctgaatcgcatgaccggcatggtggagaagccgcccctcggg
accgagccgtccaacctgttcatctcgggccgctacgtcctgacgcccgacatcttcccg
ttgctggccgaccagcagacgggggcgggcggcgagatccagctgaccgacgccatggcg
cggctgatgaaggtcaaggatttccacgccctggagtacgagggcgcgacctacgactgc
ggcgatccggtcggcctgctgcgggccaatgtcgcctatgcgctggagcacgcatcactg
agcgaggcggcgcgggcggcggtgacgggcctcctctag

DBGET integrated database retrieval system