KEGG   Brevundimonas subvibrioides: Bresu_0486Help
Entry
Bresu_0486        CDS       T01291                                 

Definition
(GenBank) Nucleotidyl transferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bsb  Brevundimonas subvibrioides
Pathway
bsb00040  Pentose and glucuronate interconversions
bsb00052  Galactose metabolism
bsb00500  Starch and sucrose metabolism
bsb00520  Amino sugar and nucleotide sugar metabolism
bsb01100  Metabolic pathways
bsb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bresu_0486
   00052 Galactose metabolism
    Bresu_0486
   00500 Starch and sucrose metabolism
    Bresu_0486
   00520 Amino sugar and nucleotide sugar metabolism
    Bresu_0486
Enzymes [BR:bsb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bresu_0486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADK99800
UniProt: D9QKH5
Position
482887..483765
Genome map
AA seq 292 aa AA seqDB search
MTTSPSRVRKAVLPVAGLGTRVLPAAKTTPKNMLNVFDRPILSHIVEEARASGIEHIIFV
VGRGQGSIEDYFDHAYEMEAILKAKGKDDILAQVVADLPKPGEMSYVRQMAPLGLGHAVF
CARDLIGDEPFAVMLPDMLMMADTPALKQAIDAHEKTGGNVVVVEQAPEGETHKYGIVAL
DGQDGRLNRMTGMVEKPPLGTEPSNLFISGRYVLTPDIFPLLADQQTGAGGEIQLTDAMA
RLMKVKDFHALEYEGATYDCGDPVGLLRANVAYALEHASLSEAARAAVTGLL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaccacatcgccgtctcgcgtccgcaaggccgtcctgcccgtcgccgggctgggcacc
cgggtcctgcccgccgccaagaccacgcccaagaacatgctgaacgtgttcgaccggccg
atcctgtcgcacatcgtcgaggaggcgcgcgcctcgggcatcgaacacatcatcttcgtc
gtcggacgcggccagggctcgatcgaggactatttcgaccacgcctacgagatggaggcg
atcctcaaggccaagggcaaggacgacatcctggcccaggtggtggccgacctgccgaag
cccggcgagatgagctacgtgcgccagatggctccgctgggtctgggtcacgccgtcttc
tgcgcccgcgacctgatcggcgacgagcctttcgcggtcatgctgcccgacatgctgatg
atggccgacacccccgcgctgaagcaggccatcgacgcccatgaaaagaccggcggcaat
gtcgtcgtggtcgaacaggccccggaaggcgagacccacaaatacggcatcgtcgcgctc
gacggtcaggacggtcggctgaatcgcatgaccggcatggtggagaagccgcccctcggg
accgagccgtccaacctgttcatctcgggccgctacgtcctgacgcccgacatcttcccg
ttgctggccgaccagcagacgggggcgggcggcgagatccagctgaccgacgccatggcg
cggctgatgaaggtcaaggatttccacgccctggagtacgagggcgcgacctacgactgc
ggcgatccggtcggcctgctgcgggccaatgtcgcctatgcgctggagcacgcatcactg
agcgaggcggcgcgggcggcggtgacgggcctcctctag

DBGET integrated database retrieval system