KEGG   Brevundimonas subvibrioides: Bresu_0572Help
Entry
Bresu_0572        CDS       T01291                                 

Definition
alpha/beta hydrolase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bsb  Brevundimonas subvibrioides
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bsb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Bresu_0572
Enzymes [BR:bsb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Bresu_0572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
580045..581055
Genome map
AA seq 336 aa AA seqDB search
MNRAAAFAANAPLMGVPGAAAPPGGTGDWFRGAGGLRLRAAFWTPSTLVAARPRGTVILS
PGRTEPIEKYFEVIGNFLARGWCVLAHDWRGQGLSARLLPDRLKGHARAVEEFLDDYSRL
LDAFETRAPKPWIAVGHSMGGTLNLLSLEAGESRFAGAILSSPMLRIKTGKRSMWSVKLA
VRWNVRHGKAGDFVLDDPDDPFDHTFEKDALTSDEGRYEMWRQQLYACPHLAVGGPTWGW
LAFGIDAGERSLKPKALKSVTIPCTIVQSGEDDRVWKQTNRWAAKRLGRGRYVEVAGARH
EIIMETDDLRAVFLHEFDAMADYVSPVNDLAPVPAD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccgcgccgccgcctttgccgccaatgcgcccctgatgggggttcccggtgccgcc
gccccgcccggagggaccggcgactggttccgcggtgccgggggccttcgcctgcgcgcc
gccttctggaccccgtccaccctcgtcgccgcccggccgcgcggcacggtgatcctgagc
cccggccggaccgagccgatcgagaaatatttcgaggtcatcggcaacttcctggcgcgg
ggctggtgcgtcctggcccacgactggcgcggtcagggcctgtcggcccgccttctgccc
gaccgcctgaagggtcacgcccgggcggtcgaggagttcctcgacgactattcgcggctg
ctggacgccttcgagacgcgggcccccaagccgtggatcgcggtcggccattcgatgggc
gggacgctgaatctgctgagcctcgaggccggtgaaagccgtttcgcgggcgcgatcctg
tccagccccatgctgcgcatcaaaaccggcaagcggtcgatgtggtcggtcaagctggcg
gtgcgctggaacgtccgtcacggcaaggcgggcgacttcgtgctggacgatcccgacgat
cccttcgaccacaccttcgagaaggacgccctgacgtccgacgagggccgctacgagatg
tggcgccagcagctctatgcctgcccgcatctggccgtcggtggcccgacctggggctgg
ctggccttcggcatcgacgcgggtgagcgttcgctgaagcccaaggcgctgaagtctgtg
accattccttgcacgatcgtgcagtcgggcgaggacgaccgggtctggaaacagaccaac
cgctgggcagccaagcggctgggccgcggacgctatgtcgaggtggcgggggcccggcac
gagatcatcatggagaccgacgacctgcgcgccgtcttcctgcatgagttcgacgccatg
gcggactatgtgtcgccggtgaacgatctggctcccgtcccggccgactga

DBGET integrated database retrieval system