KEGG   Brevundimonas subvibrioides: Bresu_0610Help
Entry
Bresu_0610        CDS       T01291                                 

Definition
3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bsb  Brevundimonas subvibrioides
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bsb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bresu_0610
   01212 Fatty acid metabolism
    Bresu_0610
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Bresu_0610
   00650 Butanoate metabolism
    Bresu_0610
  Lipid metabolism
   00071 Fatty acid degradation
    Bresu_0610
   01040 Biosynthesis of unsaturated fatty acids
    Bresu_0610
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bresu_0610
   00310 Lysine degradation
    Bresu_0610
   00380 Tryptophan metabolism
    Bresu_0610
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bresu_0610
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bresu_0610
   00281 Geraniol degradation
    Bresu_0610
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Bresu_0610
Enzymes [BR:bsb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Bresu_0610
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Bresu_0610
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Bresu_0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
614512..616689
Genome map
AA seq 725 aa AA seqDB search
MENFKIDVDADGIALITFDVPGRSMNTLTGKVMDELPALVERIKTDDAIKGAVITSGKAS
GFCAGADLGDMASGLLSGSGDLQAAYDAGWKMNGALRALETCGKPVAAAINGLALGGGLE
VTLACHYRVVGDSPKIQLGLPEIKVGLFPGGGGTQRLTRLIGVQAAMTAMSSGSSWRPND
AKGAGVVHEVVPAGTEVEAAKAWIKGGGKAVQPWDDKSFKLPGGGPYHPAGIQNFLVGNA
MIRKQSYGNYPAVTNLMKAVYEGTQVPMDAALRIETRYFIKTLMTPQAQGMIRSLFLSKQ
ELDKGAVRPAGIPQSDPKKVTVIGAGMMGAGIAYVQALAGIQTILIDRDQDAADKGKAHV
EELLKKRLSRGQLTQDKFDALLASVVATTDYDQIKGSDLVIEAVFENREIKADVTKRAEA
QLEAGAVFGSNTSTLPITGLAEASVRPEDFIGIHFFSPVDKMMLVEIILGEKTGPAAIAK
ALDYIIKIKKTPIVVNDGRGFYTSRCFGTYVAEGLAMLEEGYAPALIDNLGRMTGMPRGP
LEMHDDVALDLSVKIAKQTAEDLGDAYVPIEGHEIVRKMVEDLGRYGRKNGKGFYDYDTK
PKKLWSGLSDLATVTINDSTPELIEDQKRRLLYRQAVEVAKCWEEGVIDDPREADVGAIL
AWGFAPWTGGPITMIDQIGLKAFVEQADVYADRYGDRFRVPQLLRDMAAKGETFYGKFAG
VKAAA
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacttcaagatcgacgtcgacgccgacggcatcgccctgatcaccttcgacgtc
cccggacggtcgatgaacaccctgaccggcaaggtcatggacgagctgccggccctggtc
gaacgcatcaagaccgacgacgccatcaagggcgcggtcatcacctcgggcaaggcttcc
ggcttctgcgccggggcggacctgggcgacatggcgtcgggactgctgtccggctcgggc
gacttgcaggcggcgtacgacgccggctggaagatgaacggcgccctgcgcgcgctggag
acctgtggcaagccggtcgccgccgcgatcaacggcctggcgctcggcggcgggctggag
gtcaccctggcctgtcactaccgcgtggtcggcgacagccccaagatccagctgggcctg
cccgagatcaaggtcggcctgttccccggcggtggcggcacccagcgtctgacgcgtctg
atcggcgtccaggcggcgatgacggcgatgagctcgggctcgtcgtggcgtccgaacgac
gccaagggcgcgggcgtggtgcatgaggtcgtgcccgcgggcaccgaggtcgaggccgcc
aaggcctggatcaagggcggcggcaaggccgtccagccgtgggacgacaagtcgttcaag
ctgccgggcggcggcccctaccacccggccggcatccagaacttcctcgtcggcaatgcg
atgatccgcaagcagtcgtacggcaactacccggccgtcaccaacctgatgaaggccgtc
tatgaaggcacccaggtgccgatggacgcggcgctccgcatcgagacccgctacttcatc
aagaccctgatgacgccgcaggcccagggcatgatccgcagcctgttcctgtccaagcag
gagctcgacaagggcgcggtgcgtcccgccggcattccccagtcggaccccaagaaggtc
accgtcatcggcgccggcatgatgggcgcgggcatcgcctatgttcaggccctcgccggc
atccagaccatcctgatcgaccgcgaccaggacgccgccgacaagggcaaggcccatgtc
gaggagttgctgaagaagcggctgtcgcgcggtcagctgacccaggacaagttcgacgcc
ctgctggcctcggtcgtcgccacgaccgactatgaccagatcaagggttcggacctggtc
atcgaggcggtgttcgagaaccgcgagatcaaggcggatgtcaccaagcgcgccgaggcc
cagctggaagccggcgccgtgttcggctccaacacctcgaccctgccgatcacgggcctg
gccgaggcctcggtccggcccgaggacttcatcggcatccacttcttctcgcccgtcgac
aagatgatgctggtcgagatcatcctgggtgagaagaccggcccggcggcgatcgccaag
gcgctggactacatcatcaagatcaagaagaccccgatcgtcgtcaacgacggccgcggt
ttctacacctcgcgctgcttcggcacctatgtggccgaggggctggcgatgctggaggag
ggctatgcccccgccctgatcgacaacctgggccggatgaccggcatgccgcgcgggccg
ctggaaatgcacgacgacgtcgcgctggacctgtcggtcaagatcgccaagcagacggcc
gaagatctgggcgacgcctatgtgccgatcgaaggccacgagatcgtccgcaagatggtc
gaggacctgggtcgctatggtcgcaagaacggcaagggcttctacgactacgacaccaag
cccaagaaactctggtccggcctgtcggacctggcgaccgtcaccatcaacgactcgacc
cccgagctgatcgaggaccagaagcgccgcctgctgtatcgccaggccgtcgaggtcgcg
aaatgctgggaagagggcgtcatcgacgacccgcgcgaggccgacgtcggcgccatcctg
gcctggggcttcgcgccctggaccggcggccccatcaccatgatcgaccagatcggtctg
aaggccttcgtggaacaggccgacgtctatgccgaccgctacggcgaccgcttccgcgtg
ccgcagctgctgcgcgacatggcggcaaagggcgagaccttctacggcaagttcgccggg
gtgaaggccgcggcctga

DBGET integrated database retrieval system