KEGG   Brevundimonas subvibrioides: Bresu_1064Help
Entry
Bresu_1064        CDS       T01291                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bsb  Brevundimonas subvibrioides
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1068023..1069009
Genome map
AA seq 328 aa AA seqDB search
MTQLNRRTLLTAAAGTALTTLAACDEATMTSIQARLNPTQAAGGSGVAANAPTQAAAAEA
SAVSQTVRMPGEPWTFARFNAAMEASRRPHTLTEAQFTEIQARKPAAIERIRTYLDGRFG
AADPNVVQAFESVPRDYFHYAYAAGASTAYQAYEANPKPWAIGHGSVLSDYLGQAYMTQL
AAPKPTDVTLEIGTGSGFQSSLLSRIVRDAYTIEIIEPIGRAVDQIFAPLGYDNVHGKVG
DGYFGWPEVTEGFDTIMLTCVAQYAPPELFRQLKPGGKLIIPIGQPFRRGQVLYVYTKDA
DGRVRSRRDVGVFFIPMTGAMQTQARPA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacccagctgaaccgccgcaccctgctgaccgccgcagcgggcaccgccctgaccacg
ctggccgcctgcgacgaggccacgatgacgtccatccaggcgcgcctgaatccgacgcag
gcggccgggggatcgggcgtcgccgccaatgccccgacccaggccgccgccgccgaggcc
tcagccgtgtcgcagacggtccggatgccgggcgagccctggaccttcgcccgcttcaat
gcggcgatggaggcttccaggcgcccccacaccctgaccgaggcccagttcaccgagatc
caggcgcgcaaacccgccgccatcgagcgcatcaggacctacctcgacgggcggttcggc
gcggccgatccgaacgtggtccaggccttcgaaagcgtgccgcgcgactatttccactac
gcctatgccgccggggcctcgaccgcttaccaggcctatgaggccaaccccaagccctgg
gccatcggccacgggagtgtcctctcagactatctgggccaggcctatatgacccagctg
gcggcccccaagccgaccgatgtgacgctggagatcgggaccggatcgggcttccagtcg
tccctgctcagccgcatcgtccgcgacgcctatacgatcgagatcatcgagccgatcggc
cgggcggtggaccagatcttcgcgccgctcggctacgacaacgtccacggcaaggtcggc
gacggctatttcggctggcccgaggtgaccgagggcttcgacaccatcatgctgacctgc
gtcgcccagtacgccccgcccgagctgttccgccagctcaagccgggcggcaagctgatc
atcccgatcggccagccgttccgccgcgggcaggtgctgtatgtctacaccaaggacgcc
gatggccgggtccgcagccgccgcgacgtcggcgtgttcttcatcccgatgacgggcgcg
atgcagacccaggccagaccggcctag

DBGET integrated database retrieval system