KEGG   Brevundimonas subvibrioides: Bresu_1186Help
Entry
Bresu_1186        CDS       T01291                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bsb  Brevundimonas subvibrioides
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:bsb00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1193848..1194630
Genome map
AA seq 260 aa AA seqDB search
MTASLIADLASGALHDHIAEIAEDAARVILPYWRAGGEVFTKADASPVTLADQQAEALIL
SRLSALYPDVQAVAEEQSEAEGRPASAEAVFWLIDPLDGTKGFVAGKESFTVNIALIQDH
RPVAGVVTAPATATTWRTAVGGGAEMRRFGEPWRAIKVRNRPDEGIALLSHSVTDEEATR
LAARHGCTRWQGTDSSLKFCLIAEGRFDAYPRTGPTSEWDTAAGQAVLEAAGGRVLAADG
SPLAYGKPGFANGGFVAMGG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcttccctgattgccgacctcgcctccggcgccctgcacgaccacatcgccgag
atcgccgaggacgcggcccgcgtgatcctgccctactggcgggcgggcggcgaggtgttc
accaaggccgacgccagcccggtcaccctggccgatcagcaggccgaggccctgatcctg
tcgcggctttcggccctgtatcccgacgtccaggccgtggccgaggaacagtccgaggcg
gagggtcgccccgccagcgccgaggcggtgttctggctgatcgatccgctggacggcacc
aagggcttcgtggcgggcaaggagagcttcaccgtcaacatcgccctgatccaggaccac
cgccccgtcgccggggtggtcaccgccccggccaccgcgaccacctggcgcaccgctgtc
ggcggcggggccgagatgcgccgcttcggcgagccgtggcgggcgatcaaggtccgcaac
cggcccgacgaaggcatcgccctgctcagccacagcgtcaccgacgaggaggcgacccgc
ctcgccgcccgccacggctgcacccgatggcaggggacggactcatcgctgaagttctgc
ctgatcgccgagggtcgattcgacgcctacccccgcaccggcccgacgtccgagtgggac
acagccgccggtcaggcggtgctggaggcggccggggggcgtgttctcgcggcggacggg
tcgcccctggcctacggcaagccgggctttgccaacggcggcttcgtggcgatggggggc
tag

DBGET integrated database retrieval system