KEGG   Brevundimonas subvibrioides: Bresu_1209Help
Entry
Bresu_1209        CDS       T01291                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bsb  Brevundimonas subvibrioides
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1219758..1220810
Genome map
AA seq 350 aa AA seqDB search
MIDRRALLASSLALAACGKTEAASAIDATPLKSIAPFPIGTAAMSGQFDDPAWVTLALTH
VSQLTPEWEMKMEYILSETGDYRWDAPDRIADFCTAHELRLFGTTLIWYSQDSAFFRSLD
PARFRREYDRYIAEVAGRYRGRATGWDVVNEAVAEDGNGLRSCLWSDALGQEGYIARAFE
QAKIADPDAVLFLNDYNLENNPVKGATFLRLIERLLKAGVPVGGIGTQSHLDIEIPADQT
RAFFREAAQFGLPIHVSELDASLRAEGRIDTRSPRQKIDQQTARVTELTEAFVSLPPAQR
FAFTVWGMRDTDSWLRRDARDDGKDSPLLFDAGGLPNPMFAAVAGAIRPA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgaccggcgagcccttctcgcctcctccctcgccctggccgcctgcgggaagacc
gaggccgcgtcggcgatcgacgccacgcccctgaaatccatcgcgcctttccccatcggg
acggccgccatgagcggtcagttcgacgatccggcctgggtgaccctggccctgacgcac
gtctcccagctcacgccggagtgggagatgaagatggagtacatcctgtcggagaccggc
gactatcgctgggacgcccccgaccggatcgccgacttctgcaccgcccatgagcttcga
ctcttcggcaccaccctgatctggtactcccaggacagtgccttcttccggtcgctggac
cccgcgcggttccggcgcgagtacgaccgctatatcgccgaggtcgccggacgttaccgc
ggccgggccacgggctgggacgtcgtcaacgaggcggtggccgaggacggcaacggcctg
cggtcctgcctgtggtccgacgccctggggcaggaaggctatatcgcccgcgcgttcgag
caggcgaagatcgccgatccggacgcggtcctgttcctgaacgactacaatctggagaac
aatccggtgaagggcgcgaccttcctgcggctaatcgagcgtctgctgaaggcgggcgtc
cccgtcggcggcatcggcacccagtcgcacctcgacatcgagatccccgccgaccagacc
cgcgcctttttccgcgaggccgcgcagttcggcctgccgatccatgtgtcggagctggac
gcatccctgcgtgctgagggccgcatcgacacccgctcgccccgccagaagatcgaccag
cagaccgcccgcgtcacggaactgaccgaggccttcgtgtccctgccgccggcccagcgg
ttcgccttcaccgtctgggggatgcgcgacaccgacagctggctgcggcgcgatgcgcgc
gacgacggcaaggacagccccctgctgttcgatgccggcggcctgccgaacccgatgttc
gccgcggtggccggggcgatccggcccgcctag

DBGET integrated database retrieval system