KEGG   Brevundimonas subvibrioides: Bresu_1280Help
Entry
Bresu_1280        CDS       T01291                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
bsb  Brevundimonas subvibrioides
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bresu_1280
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Bresu_1280
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bresu_1280
Enzymes [BR:bsb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Bresu_1280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1282492..1284204
Genome map
AA seq 570 aa AA seqDB search
MAIDRRKVLRLLGVGAGASGYAATGASAMAGGQAETVTFDHGVASGDPSETSVLLWTRVG
TERPSLDLDWQVAEHEGFETIVARGTTTTSAARDHTVKVIAGGLKPGRDYFYRFVSDGGQ
TSPVGRTRTLPAASSVAPVVLAVASCSLHPNGLFNAYDAIANMERLDAVVHLGDYIYEYG
AGENDYGMANGRRLNRIPEPAHEILTLADYRARHAQYKADPDLQAAHARAPWIVVFDDHE
TANDSYDGGAENNEAGEADWSTRKAVALQAYFEWMPIREPEAGKGLAEATERSFRFGRAA
SLHMVETRLLARTKQLDYAADFYVPGADGKPTPDRDAFFARLNDPERRLLGDRQLSWIER
DAKAAVDAGCAWQLIGNQVVMARVKGPNIGAMVPAETIEAAISTLAPGIQTRVRQIVALF
GQDVPFNLDAWDGYPAERERLYAALKRAGARPVVLAGDSHTFWVDALKDASGAKAGIEFG
TTGVTSPSPAGFLGLPEAQLAQVMAAQNEEVEYVDFGPRGYIALTLTPETVRAELIGVST
IDSKPYTTTVVRRYEVRAEGRGQFGDLVQV
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggccattgatcgccgtaaagtccttcgtctgctgggcgtcggagcgggggcttccggc
tatgccgcgaccggcgcgtcggccatggcgggcggccaggccgagaccgtcaccttcgac
cacggcgtggcctcgggggacccgtccgaaacctcggtgctgttgtggacgcgggtcgga
acggagcggccgtccctggatctggactggcaggtcgccgagcacgagggatttgaaacg
atcgtcgcgcgcggcacgacgaccacgtcggcggcgcgagaccacacggtcaaggtgatt
gccggggggctgaagcccggccgggactatttctatcggttcgtgtcggacggcggccaa
acctcgccggtcggtcgaacgcggaccctgccggccgcatcatcggtcgccccggttgtg
ttggcggtggcgtcctgctccctgcatcccaacggcctgttcaacgcctatgacgccata
gcgaacatggaacgtctggatgccgtcgtgcacctgggcgactacatctacgaatatggt
gcgggcgagaacgactacggcatggctaacggccgcaggctgaaccgtatccccgagccc
gcccacgaaatcctgaccctggccgactaccgggcccgtcacgcccagtacaaggccgac
ccggacctgcaggccgcccatgcgcgggcaccgtggatcgtggtttttgacgatcacgag
accgcaaacgacagctatgacggcggggccgaaaacaacgaggcaggcgaggccgactgg
tcgacgcgcaaggccgtcgcgcttcaggcctatttcgaatggatgccgatccgcgaaccc
gaggccggcaagggcctggccgaggcgacggaacgcagcttccgcttcgggcgcgcagcc
tcgctgcacatggtggagacgcgcctgctggcccgcacaaaacagctggattacgcggcc
gacttctatgtgccgggcgcggacggcaagccgaccccggaccgcgacgccttcttcgcc
aggttgaacgaccccgagcgacgtctgctgggcgaccgacagctgagctggatcgagcgt
gacgccaaggccgctgtcgatgcgggctgcgcctggcagttgatcggcaatcaggtcgtg
atggcgcgggtcaagggccccaacatcggcgcgatggtcccggcagagaccatcgaggcg
gcgatctccaccctggctcccggcatccagacaagggtacgccagatcgtcgccctgttt
ggtcaggacgtgcccttcaatctggacgcctgggatggctatccggccgagcgcgagcgg
ctgtatgccgccctgaagcgggcaggggcacgcccggtggttctggccggtgacagccac
accttctgggtcgatgcgctgaaggatgcgtcaggggccaaggccgggatcgagttcggc
acgacgggcgtgaccagccccagtcccgccggtttcctgggactgcccgaggcccagctg
gctcaggtcatggcggcccagaacgaagaggtcgagtacgtcgatttcggaccgcgcggc
tatatcgccctgaccctgacgcccgaaaccgtccgggcggaactgatcggcgtctcgacg
atcgattccaagccctacacgaccacggtggtgcgccggtacgaggtccgggccgagggc
cggggccagttcggcgatctggtccaggtctga

DBGET integrated database retrieval system