KEGG   Brevundimonas subvibrioides: Bresu_1695Help
Entry
Bresu_1695        CDS       T01291                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bsb  Brevundimonas subvibrioides
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bsb01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bsb00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1670077..1671357
Genome map
AA seq 426 aa AA seqDB search
MTTFADLVPSPAGRFDGIERPYTPEDVLKLRGSVPITHTLAERGANRLWELLHSEPYINA
LGAVTGNQAMQMVRAGLKAIYLSGWQVAADANTAGAMYPDQSLYPANAAPELCRRINRTL
QRADQIEHAEGGAKRDWFVPIVADAEAGFGGPLNSFEIMKAFIEAGAAGVHFEDQLASEK
KCGHLGGKVLIPTQAHERNLIAARLAADVMGAPTITVARTDAESAQLITSDIDERDRPFI
DRDNRTPEGFFRLKEGTGLDHCIARGLSYAKIADLLWWETSHPSLEDAKKFAEAVQKEHP
GKLMAYNCSPSFNWKAKLDDATIAKFQRELGAMGYKFQFVTLAGFHALNNSMFELADGYR
DRGMAAYSELQQREFANEAIGYTATRHQREVGTGYFDQVATVISNGQSSTTAMKESTETA
QFVAAE
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccttcgccgatctcgttccatcccccgccggtcgtttcgacggcatcgagcgc
ccctacacgcccgaggatgtgctgaagctgcgcggctcggtgccgatcacccacaccctg
gccgaacgcggggccaaccgcctgtgggagctgctgcactcggaaccctacatcaacgcc
ctcggcgctgtgaccggcaaccaggccatgcagatggtccgcgcgggtctgaaggccatc
tacctgtcgggctggcaggtcgccgccgacgccaacaccgccggggccatgtatccggac
cagtcgctgtaccccgccaacgccgcgccggaactgtgccgccgcatcaaccgcaccctg
cagcgcgccgaccagatcgagcatgccgagggcggggcaaagcgcgactggttcgtgccg
atcgtggccgacgccgaggccggtttcggcggcccgctgaacagcttcgagatcatgaag
gccttcatcgaggcgggggccgcgggcgtccacttcgaggaccagctggcctccgagaag
aagtgcggccacctgggcggcaaggtgctgatcccgacccaggcgcatgagcgcaatctg
atcgccgcccgcctggccgccgacgtcatgggcgcgccgacgatcaccgtcgcccggacc
gacgccgaaagcgcccagctgatcacctccgacatcgacgagcgggaccggcccttcatc
gaccgcgacaaccgcacgcccgaaggcttcttccgcctgaaggaaggcacgggcctggac
cactgcatcgcgcgcggcctgtcctatgccaagatcgccgacctgctgtggtgggagacc
agccacccctcgctggaggacgccaagaagttcgccgaggccgtccagaaggagcacccc
ggcaagctgatggcctacaactgctcgccctccttcaactggaaggccaagctggacgac
gccaccatcgccaagttccagcgcgagctcggggccatgggctacaagttccagttcgtg
accctggccggcttccacgccctgaacaactcgatgttcgagctggccgacggctaccgt
gaccgcggcatggcggcctattccgagctgcagcagcgcgagttcgccaacgaggccatc
ggctacaccgccacccgccaccagcgcgaggtcggtaccggctacttcgaccaggtcgcc
accgtcatttccaacgggcagtcctccacgaccgccatgaaggaatccaccgaaaccgcg
cagttcgtcgcggcggaataa

DBGET integrated database retrieval system