KEGG   Brevundimonas subvibrioides: Bresu_1695Help
Entry
Bresu_1695        CDS       T01291                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
bsb  Brevundimonas subvibrioides
Pathway
bsb00630  Glyoxylate and dicarboxylate metabolism
bsb01100  Metabolic pathways
bsb01110  Biosynthesis of secondary metabolites
bsb01120  Microbial metabolism in diverse environments
bsb01200  Carbon metabolism
Module
bsb_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bsb00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Bresu_1695
Enzymes [BR:bsb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Bresu_1695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ADL01006
UniProt: D9QH40
Position
1670077..1671357
Genome map
AA seq 426 aa AA seqDB search
MTTFADLVPSPAGRFDGIERPYTPEDVLKLRGSVPITHTLAERGANRLWELLHSEPYINA
LGAVTGNQAMQMVRAGLKAIYLSGWQVAADANTAGAMYPDQSLYPANAAPELCRRINRTL
QRADQIEHAEGGAKRDWFVPIVADAEAGFGGPLNSFEIMKAFIEAGAAGVHFEDQLASEK
KCGHLGGKVLIPTQAHERNLIAARLAADVMGAPTITVARTDAESAQLITSDIDERDRPFI
DRDNRTPEGFFRLKEGTGLDHCIARGLSYAKIADLLWWETSHPSLEDAKKFAEAVQKEHP
GKLMAYNCSPSFNWKAKLDDATIAKFQRELGAMGYKFQFVTLAGFHALNNSMFELADGYR
DRGMAAYSELQQREFANEAIGYTATRHQREVGTGYFDQVATVISNGQSSTTAMKESTETA
QFVAAE
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccttcgccgatctcgttccatcccccgccggtcgtttcgacggcatcgagcgc
ccctacacgcccgaggatgtgctgaagctgcgcggctcggtgccgatcacccacaccctg
gccgaacgcggggccaaccgcctgtgggagctgctgcactcggaaccctacatcaacgcc
ctcggcgctgtgaccggcaaccaggccatgcagatggtccgcgcgggtctgaaggccatc
tacctgtcgggctggcaggtcgccgccgacgccaacaccgccggggccatgtatccggac
cagtcgctgtaccccgccaacgccgcgccggaactgtgccgccgcatcaaccgcaccctg
cagcgcgccgaccagatcgagcatgccgagggcggggcaaagcgcgactggttcgtgccg
atcgtggccgacgccgaggccggtttcggcggcccgctgaacagcttcgagatcatgaag
gccttcatcgaggcgggggccgcgggcgtccacttcgaggaccagctggcctccgagaag
aagtgcggccacctgggcggcaaggtgctgatcccgacccaggcgcatgagcgcaatctg
atcgccgcccgcctggccgccgacgtcatgggcgcgccgacgatcaccgtcgcccggacc
gacgccgaaagcgcccagctgatcacctccgacatcgacgagcgggaccggcccttcatc
gaccgcgacaaccgcacgcccgaaggcttcttccgcctgaaggaaggcacgggcctggac
cactgcatcgcgcgcggcctgtcctatgccaagatcgccgacctgctgtggtgggagacc
agccacccctcgctggaggacgccaagaagttcgccgaggccgtccagaaggagcacccc
ggcaagctgatggcctacaactgctcgccctccttcaactggaaggccaagctggacgac
gccaccatcgccaagttccagcgcgagctcggggccatgggctacaagttccagttcgtg
accctggccggcttccacgccctgaacaactcgatgttcgagctggccgacggctaccgt
gaccgcggcatggcggcctattccgagctgcagcagcgcgagttcgccaacgaggccatc
ggctacaccgccacccgccaccagcgcgaggtcggtaccggctacttcgaccaggtcgcc
accgtcatttccaacgggcagtcctccacgaccgccatgaaggaatccaccgaaaccgcg
cagttcgtcgcggcggaataa

DBGET integrated database retrieval system