KEGG   Brevundimonas subvibrioides: Bresu_1695Help
Entry
Bresu_1695        CDS       T01291                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bsb  Brevundimonas subvibrioides
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bsb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bresu_1695
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Bresu_1695
Enzymes [BR:bsb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Bresu_1695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1670077..1671357
Genome map
AA seq 426 aa AA seqDB search
MTTFADLVPSPAGRFDGIERPYTPEDVLKLRGSVPITHTLAERGANRLWELLHSEPYINA
LGAVTGNQAMQMVRAGLKAIYLSGWQVAADANTAGAMYPDQSLYPANAAPELCRRINRTL
QRADQIEHAEGGAKRDWFVPIVADAEAGFGGPLNSFEIMKAFIEAGAAGVHFEDQLASEK
KCGHLGGKVLIPTQAHERNLIAARLAADVMGAPTITVARTDAESAQLITSDIDERDRPFI
DRDNRTPEGFFRLKEGTGLDHCIARGLSYAKIADLLWWETSHPSLEDAKKFAEAVQKEHP
GKLMAYNCSPSFNWKAKLDDATIAKFQRELGAMGYKFQFVTLAGFHALNNSMFELADGYR
DRGMAAYSELQQREFANEAIGYTATRHQREVGTGYFDQVATVISNGQSSTTAMKESTETA
QFVAAE
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccttcgccgatctcgttccatcccccgccggtcgtttcgacggcatcgagcgc
ccctacacgcccgaggatgtgctgaagctgcgcggctcggtgccgatcacccacaccctg
gccgaacgcggggccaaccgcctgtgggagctgctgcactcggaaccctacatcaacgcc
ctcggcgctgtgaccggcaaccaggccatgcagatggtccgcgcgggtctgaaggccatc
tacctgtcgggctggcaggtcgccgccgacgccaacaccgccggggccatgtatccggac
cagtcgctgtaccccgccaacgccgcgccggaactgtgccgccgcatcaaccgcaccctg
cagcgcgccgaccagatcgagcatgccgagggcggggcaaagcgcgactggttcgtgccg
atcgtggccgacgccgaggccggtttcggcggcccgctgaacagcttcgagatcatgaag
gccttcatcgaggcgggggccgcgggcgtccacttcgaggaccagctggcctccgagaag
aagtgcggccacctgggcggcaaggtgctgatcccgacccaggcgcatgagcgcaatctg
atcgccgcccgcctggccgccgacgtcatgggcgcgccgacgatcaccgtcgcccggacc
gacgccgaaagcgcccagctgatcacctccgacatcgacgagcgggaccggcccttcatc
gaccgcgacaaccgcacgcccgaaggcttcttccgcctgaaggaaggcacgggcctggac
cactgcatcgcgcgcggcctgtcctatgccaagatcgccgacctgctgtggtgggagacc
agccacccctcgctggaggacgccaagaagttcgccgaggccgtccagaaggagcacccc
ggcaagctgatggcctacaactgctcgccctccttcaactggaaggccaagctggacgac
gccaccatcgccaagttccagcgcgagctcggggccatgggctacaagttccagttcgtg
accctggccggcttccacgccctgaacaactcgatgttcgagctggccgacggctaccgt
gaccgcggcatggcggcctattccgagctgcagcagcgcgagttcgccaacgaggccatc
ggctacaccgccacccgccaccagcgcgaggtcggtaccggctacttcgaccaggtcgcc
accgtcatttccaacgggcagtcctccacgaccgccatgaaggaatccaccgaaaccgcg
cagttcgtcgcggcggaataa

DBGET integrated database retrieval system