KEGG   Brevundimonas subvibrioides: Bresu_1817Help
Entry
Bresu_1817        CDS       T01291                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bsb  Brevundimonas subvibrioides
Brite
Enzymes [BR:bsb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Bresu_1817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1803743..1804372
Genome map
AA seq 209 aa AA seqDB search
MDFAAARKVMVDSQVRVNDVTDRGLQAALLAVPREHFCAADRAFAAYGEVEVEIAGDRRL
MQAREVAKLLQALDARPGETALAIAAPYAAAVLADLGLKVTAQEADPAVAEVVAPALDDA
GVVMHVGPLTTPTGADWDLIVSEGAVAARPTAWLERLRIGGRLAVVERSGPNGRAVLYVR
GREGYSRRELFDAAPPVLAEMTPAPAFAL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggatttcgcagccgcacgcaaggtcatggtcgactcccaggtgcgggtgaacgacgtc
accgaccggggcttgcaggccgccctgctggccgtgccgcgtgagcacttctgtgccgcc
gatcgggcctttgccgcctatggcgaggtcgaggtcgagatcgcgggcgaccgtcgcctg
atgcaggcccgcgaggtcgccaagctgttgcaggcgctggacgcgcgtccgggcgagacc
gccctggccatcgccgccccatatgccgccgccgtcctggccgatctggggctcaaggtg
acagcccaggaagccgacccggccgtggccgaggttgtcgctccggcgctggacgatgcc
ggagtcgtgatgcatgtcgggcccctgaccacgccgaccggggcagactgggatctgatc
gtcagcgagggtgccgtcgccgcccggcccaccgcctggctggaaaggctgcggatcggc
ggtcggctggccgtggtggagcgcagcgggccgaatggtcgcgccgtcctctatgtgcgg
ggccgcgagggctattcgcgccgcgaattgttcgatgccgcgccgccggttctggccgaa
atgacacccgcgcccgccttcgcgctgtga

DBGET integrated database retrieval system