KEGG   Brevundimonas subvibrioides: Bresu_1985Help
Entry
Bresu_1985        CDS       T01291                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bsb  Brevundimonas subvibrioides
Pathway
bsb00010  Glycolysis / Gluconeogenesis
bsb00020  Citrate cycle (TCA cycle)
bsb00620  Pyruvate metabolism
bsb01100  Metabolic pathways
bsb01110  Biosynthesis of secondary metabolites
bsb01120  Microbial metabolism in diverse environments
bsb01130  Biosynthesis of antibiotics
bsb01200  Carbon metabolism
Module
bsb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bsb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bresu_1985
   00020 Citrate cycle (TCA cycle)
    Bresu_1985
   00620 Pyruvate metabolism
    Bresu_1985
Enzymes [BR:bsb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bresu_1985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_3 PYNP_C Peptidase_M23 GCV_H DUF2118
Motif
Other DBs
NCBI-ProteinID: ADL01296
UniProt: D9QI38
Position
1961429..1962751
Genome map
AA seq 440 aa AA seqDB search
MTDILMPALSPTMEEGVLAKWHVKVGDTVKAGDVIAEIETDKATMEVEAVDEGTITDILV
AEGSEGVKVNTPIARLAEEGGSAAPAPKAAEPAKAEAPKAAPAPAGHESGDAVATPDGIK
SAEAVLPKTSGTAASTGARVFSSPLARRLAKDAGLDLSTLKGTGPHGRIVKADVEAAAKG
GARPAAAPATTAASGIEARKVQSLADMGIPDGSYDLIPLDGMRKAIARRMVGSIQNVPHF
PLFIDVEIDALLAARAKVNAMLEKSGVKVSVNDFVIKAAAMALKLVPEANASYSPEGIAM
HHNADVAMAVAIDGGLITPIIFKAETKSLSQIAVESKDLAKRARDKKLKPEEFQGGTFSV
SNLGMFGIKAFSSIINEPQGAIMSVGAGEQRPVVKNGQLAVATVMTVTLTCDHRVVDGAT
GARFLQAFKPLIEDPVTMLA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatcctgatgcccgccctgtcgcccacgatggaagagggcgtcctggccaaa
tggcacgtcaaggtcggcgacacggtcaaggccggcgacgtcatcgccgagatcgagacc
gacaaggcgaccatggaggtcgaggccgtcgacgaaggcacgatcaccgacatcctggtg
gccgaaggctccgagggcgtgaaggtcaatacgccgatcgcccgtctggcggaggagggc
ggttccgccgccccggcacccaaggccgctgaacccgcgaaagccgaggcgccgaaggct
gcgcccgcgcccgcaggtcacgagagcggcgatgcggtggcgacgcccgacgggatcaag
tccgccgaagccgtcctgcccaaaacctccggcacggccgcctcgaccggggcccgcgtc
ttctcgtcgccgctcgcgcgtcggctggccaaggacgccggactggacctgtcgaccctg
aagggcaccggcccccacggccggatcgtcaaggccgacgtcgaggctgctgccaagggc
ggcgcgcggccggccgcagcgcccgccacgaccgccgcttccggcatcgaggcccgcaag
gtccagtcgctggccgacatgggcatccccgacggcagctacgatctcatcccgctggac
ggtatgcgcaaggcgatcgcccggcgcatggtcggctcgatccagaacgtgccgcacttc
ccgctgttcatcgacgtcgagatcgacgcactgctggccgcccgggccaaggtcaatgcg
atgctggagaagtccggcgtcaaggtctcggtcaacgacttcgtcatcaaggccgcggcc
atggcgctgaagctcgtgcccgaggccaacgccagctattcgcccgagggcatcgcgatg
caccacaacgccgacgtggcgatggcggtggcgatcgacggcggcctgatcaccccgatc
atcttcaaggccgagaccaagtccctgtcgcagatcgctgtcgaatcgaaggatctggcc
aagcgcgcccgcgacaagaagctgaagcccgaggaattccagggcggcaccttcagcgtg
tccaacctgggcatgttcggcatcaaggccttcagctcgatcatcaacgagccccagggc
gcgatcatgagcgtcggggccggcgaacaacggcctgtggtgaagaacggccagctggcc
gtggcgaccgtgatgaccgtgaccctgacctgcgatcaccgggtggtggacggggcgacg
ggcgcgcggttcctgcaggccttcaagccgctgatcgaagaccctgtcaccatgctggcc
tga

DBGET integrated database retrieval system