KEGG   Brevundimonas subvibrioides: Bresu_2080Help
Entry
Bresu_2080        CDS       T01291                                 

Definition
glycoside hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
bsb  Brevundimonas subvibrioides
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Bresu_2080
  Lipid metabolism
   00600 Sphingolipid metabolism
    Bresu_2080
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Bresu_2080
Enzymes [BR:bsb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Bresu_2080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2075669..2078134
Genome map
AA seq 821 aa AA seqDB search
MRPSRRVILQGSAGAVAALSLGAFAPAEAAQAVQASSSRRTRLDHDWRFALGHAQDPARD
FDFGLDQATYAKAGRKVASAAAAGFDDSGWRSVRLPHDWAIDLPFVANPNPPPVGEDDPK
AAHGFKPLGREHPETSVGWYRHTLDLPADLAGKRLSLEFDGAFRDVVVLLNGFIVHEHEG
GYSPFRVDITDIAAPGELNVLTVRVDASLGEGWFYEGAGLYRHVWLVATDPVHVPQWGVM
VRAEPVGTDARAAVVIDLKNEADPEAVCQVDMRVVDSDGVQVAEDTATTTLAGWNEAQVE
RTLTWHRVRLWSTGTPHLYRLIAEVRVDGRLVDRYEQPFGVRTAVFDAARGFFLNGQPLK
LLGACCHQDHAGVGAAIPDRLQVWRLEQLKAMGCNAYRASHNPPTPELMDACDAMGILVI
TETRRMASDDAALAELEALVRRDRNRPSVIAWSIGNEEQAIQGTERGARIATTMVRLINQ
LDPTRPTTAALDQDFGEGVSPAVDILGFNYRTPLMEGYHARVPTQPILGSETGSTVQTRG
EYVRDDARHIVPAYDTEHPWWASTAEAWWTLAAERPYIAGGFIWTGFDYRGEPTPFNRWP
SVASYFGAMDSCGFPKDNYWYYRAWWRPEPLVHLFPHWNWAGREGEAIPVWVHANVDRVE
LFLNGRSLGSKDVVANRHLEWSVPYAPGVIEARGFKDGRALAPVRRETAGVASRIALTGD
RTRLRADGQDVSMLKVEILDAQGRPVPAAAEPVTFDVSGPARIIGVGNGNPVSHEADRAT
TRLTFNGLAQAILQTDRTGGSITVTARAPGLRPSTLQLRAA
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgaggccgagccgtcgcgtcatccttcagggatccgccggggcggtcgccgccctgtcg
ctcggcgcgttcgcgccggcagaagcggcgcaggccgtccaggcttcatcgtcccgccgg
acaagactggaccacgactggcgtttcgcgctcggccatgcccaggacccggctcgcgat
tttgacttcggtctcgatcaggcgacctatgccaaggcaggccggaaggtcgcatcggcg
gcagccgccgggttcgacgacagtggctggcgatccgtacgactcccgcacgactgggcc
atcgatctgcctttcgtggccaacccgaacccgccgcccgtgggcgaggacgatccaaag
gccgcgcacggtttcaaacccctgggtcgcgagcaccccgagaccagcgtgggctggtat
cgacacacactggacctgcccgctgatctggcgggcaagaggctgtcgctcgagttcgac
ggcgccttccgcgacgtcgtcgtcctgctgaacggtttcatcgtccacgagcacgaaggc
ggctactcaccgttccgtgtggacatcaccgacatcgcggcgccgggcgagctgaatgtg
ctgaccgtccgcgtggacgccagcctcggtgaaggctggttctacgagggtgcgggcctg
tatcgtcatgtctggctggtcgccaccgacccggtgcacgtgccgcagtggggcgtgatg
gtccgcgccgagcccgtcggtacggacgccagggccgctgtcgtgatcgacctgaaaaac
gaggctgatcccgaggccgtgtgtcaggtcgacatgcgcgtggtcgattctgatggcgtc
caggtcgccgaagatacggcgacgacgaccctggcgggctggaacgaggctcaggtcgag
aggacgctgacctggcaccgcgtcaggctctggtccaccgggacgccgcacctgtatcgc
ctgatcgccgaggtccgtgtcgatgggcggctggtcgaccgctacgagcagccgttcggg
gtgcggaccgctgtgttcgacgctgcgcgcggcttcttcctgaacggccagcctctgaag
cttctgggggcctgctgccaccaggatcatgcaggcgtcggtgccgcgatcccggaccgc
ctgcaggtctggcgactggaacagctgaaggcgatgggctgcaacgcctatcgcgcgtcg
cacaacccgccaacacccgaactcatggatgcctgcgatgcgatgggcatcctggtcatc
accgagacccgccggatggcgtccgacgacgcggccctggccgagctggaagccctcgtc
cggcgcgatcgcaaccggccctcggtcatcgcctggtcgatcggcaacgaggagcaggcg
atccagggcacggagcgaggggcccggatcgccaccaccatggtccggttgatcaaccag
ctggacccgacccgtcccacgacggcagcgctggaccaggatttcggcgagggcgtctcg
ccggcggtcgacatcctaggcttcaactatcggaccccgctgatggagggctatcacgcc
cgcgtccccacccagccgatcctcggctcagagacgggttcgacggtccagacacgcggc
gaatacgtccgcgatgacgcccgacacatcgtgccggcctacgacaccgaacatccctgg
tgggcgtcgacggcggaggcgtggtggaccctcgcggccgagcgcccctatatcgccggc
ggcttcatctggaccgggttcgactatcgtggcgagccgacgccgttcaaccgctggccc
agcgtcgcctcctatttcggggcgatggacagctgcggattccccaaggacaattactgg
tactaccgcgcctggtggcggccggagccgctggttcatctgtttccacactggaactgg
gcagggcgcgagggcgaagccatccccgtctgggtccacgccaacgtcgaccgggtggag
ctgttcctgaatggccgctccctggggtccaaggacgtggttgcgaaccggcatctggag
tggtcggtgccctatgcgccgggcgtgatcgaggcgcgcgggttcaaggatgggcgcgcc
ctggccccggtacggcgtgaaacggccggagtggcgtcgcgcatcgctctgacaggcgac
cggacccggcttcgtgccgacggccaggacgtgtccatgctgaaggtcgagatcctcgac
gcgcagggccgtccggtccctgcggccgcggaacccgtgaccttcgatgtttcggggccc
gcccggatcatcggcgtcggcaacggcaatccggtcagccacgaggccgaccgggcgacg
acccgcctgaccttcaacggtctggcccaggcaatcctccagaccgaccgaaccggcggg
tcgatcacggtgacggcacgtgcgccgggcctgcgaccctccaccctccagcttcgcgcc
gcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system