KEGG   Brevundimonas subvibrioides: Bresu_2137Help
Entry
Bresu_2137        CDS       T01291                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bsb  Brevundimonas subvibrioides
Pathway
bsb00010  Glycolysis / Gluconeogenesis
bsb00051  Fructose and mannose metabolism
bsb00562  Inositol phosphate metabolism
bsb01100  Metabolic pathways
bsb01110  Biosynthesis of secondary metabolites
bsb01120  Microbial metabolism in diverse environments
bsb01130  Biosynthesis of antibiotics
bsb01200  Carbon metabolism
bsb01230  Biosynthesis of amino acids
Module
bsb_M00002  Glycolysis, core module involving three-carbon compounds
bsb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bsb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bresu_2137
   00051 Fructose and mannose metabolism
    Bresu_2137
   00562 Inositol phosphate metabolism
    Bresu_2137
Enzymes [BR:bsb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bresu_2137
Exosome [BR:bsb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bresu_2137
  Exosomal proteins of bladder cancer cells
   Bresu_2137
  Exosomal proteins of melanoma cells
   Bresu_2137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM IlvC
Motif
Other DBs
NCBI-ProteinID: ADL01447
UniProt: D9QIW4
Position
complement(2140132..2140914)
Genome map
AA seq 260 aa AA seqDB search
MKQSVKMIVGNWKMNGLSADLVEATALADSLSGSAPAARVALCPAATLIARMAWALNGRP
IEIGGQDCHTAAAGAHTGSISAAMLKDAGAGLVIVGHSERRQACGETDAIVAAKFEAAVA
AGLEPIVCVGETLAERETGQAVALVTVQVAASVPATAAGQAFAVAYEPVWAIGTGLTPTL
EQIAEVHAAIRAALVARLGDGGHRVPILYGGSVNPGNAAEILRVAEVGGALVGGASLKAD
SFLAIIRAAEPARVAADAQG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaatccgtgaagatgatcgtcggcaattggaaaatgaacggcctgtcggccgat
ctggtggaggccacggccctggccgacagcctgtccgggtccgcgccggcggcgcgggtg
gccctgtgtccggcggcgaccctgatcgcccggatggcttgggcgctgaacggcaggccg
atcgagatcggggggcaggactgccatacggctgcggccggggcccatacagggtcgatt
tcggcagccatgctgaaggatgccggagccgggcttgtgatcgtcggccattcggaacga
cgccaggcctgcggagagaccgacgccatcgtcgcggccaagttcgaggccgccgtggcc
gcgggtctggaacccatcgtctgcgtcggagagacgctggccgaacgcgaaaccggccag
gccgtggccctggtcaccgtccaggtggccgcctcggtgcctgccacggccgccggtcag
gccttcgcggtcgcctatgagccggtctgggccatcggaacggggctgacgccgacgctg
gagcagatcgcggaggtccacgccgcgattcgcgcggcgctggtcgcgcggctgggcgac
ggggggcaccgcgtgccgatcctgtacggcgggtcggtcaatccgggcaatgccgccgag
attctccgggttgccgaggtggggggcgccctcgtcgggggcgcgtcgctgaaggccgac
agtttcctggccatcatccgggcggccgaaccggcgcgcgttgccgctgacgcccaagga
tga

DBGET integrated database retrieval system