KEGG   Brevundimonas subvibrioides: Bresu_2169Help
Entry
Bresu_2169        CDS       T01291                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
bsb  Brevundimonas subvibrioides
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2171085..2172140
Genome map
AA seq 351 aa AA seqDB search
MSTQVQTTLRSPEAFALARRAVDEMERAGVWPTPLNFELWIHWLGDPDGALGQEMTRLLG
DGTAFTDGTAEMLAAEYLPRGRLSEEIRDAGAVLNRELSTVSEAIAKAQKSQAAYGQTLA
GASAHLESSAEPSALLGVVSTLSRATTQVQAENATLEKRLETSTKEVARLREHLEQVRRD
AMTDALTNLANRKAFDEELLRACDEAEKKRQPMSLAVLDIDHFKRFNDTWGHQTGDQVLR
YVASVIGRISKAPRVAARYGGEEFAIIFPSESAALVEAALNQIREEIGSRALRRRSTNDE
LGAVTISGGLAQRRPGETGSSLLDRADEALYASKRAGRNKITNGERLEEAA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacacaggtccagacaacgctgcgtagccccgaagcattcgctttggcccggcgc
gccgtggatgaaatggaacgtgccggcgtctggccgacgcccctgaacttcgaactgtgg
attcactggctcggtgatcccgacggcgctctcggccaggaaatgacccggttgctcggc
gacggcacggccttcaccgacggcacggccgagatgctggcggctgaatatctgccgcgc
ggccgactgtccgaggaaatccgcgatgccggcgccgtcctgaaccgcgagttgtcgacg
gtttcggaggcgatcgccaaggcccagaaatcccaggccgcctatggccagaccctggcc
ggcgcttccgcccatctggaaagctccgccgaaccgtcggccctgctcggcgtcgtctcc
acgctctccagggccaccacgcaggtccaggccgagaatgccaccctggaaaaacggctg
gaaacctcgaccaaggaggtcgcccgacttcgcgagcacctggaacaggtccgccgcgac
gccatgacggacgccctgaccaacctcgccaaccgcaaggccttcgacgaagagctgctg
cgcgcctgcgacgaggccgagaagaagcgccagccgatgagcctcgcggtgctcgacatc
gaccatttcaagcgcttcaacgacacctggggccaccagaccggcgatcaggtcctgcgg
tatgtcgccagcgtcatcggccgcatctccaaggccccgcgcgtcgcggcccgctacggt
ggcgaagagttcgccatcatcttcccctccgaaagcgctgcgctggtggaagccgccctg
aaccagattcgggaagagatcggcagccgcgccctgcgccggcggtccaccaacgacgag
ctcggggccgtcaccatctccggcggtctggcccagcgccgccccggcgagaccggatcc
tcattgctcgaccgcgccgacgaggcgctctatgcgtccaaacgggccggccggaacaag
atcaccaacggtgagcgcctggaagaagccgcctga

DBGET integrated database retrieval system