KEGG   Brevundimonas subvibrioides: Bresu_2169Help
Entry
Bresu_2169        CDS       T01291                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
bsb  Brevundimonas subvibrioides
Brite
Enzymes [BR:bsb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Bresu_2169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2171085..2172140
Genome map
AA seq 351 aa AA seqDB search
MSTQVQTTLRSPEAFALARRAVDEMERAGVWPTPLNFELWIHWLGDPDGALGQEMTRLLG
DGTAFTDGTAEMLAAEYLPRGRLSEEIRDAGAVLNRELSTVSEAIAKAQKSQAAYGQTLA
GASAHLESSAEPSALLGVVSTLSRATTQVQAENATLEKRLETSTKEVARLREHLEQVRRD
AMTDALTNLANRKAFDEELLRACDEAEKKRQPMSLAVLDIDHFKRFNDTWGHQTGDQVLR
YVASVIGRISKAPRVAARYGGEEFAIIFPSESAALVEAALNQIREEIGSRALRRRSTNDE
LGAVTISGGLAQRRPGETGSSLLDRADEALYASKRAGRNKITNGERLEEAA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacacaggtccagacaacgctgcgtagccccgaagcattcgctttggcccggcgc
gccgtggatgaaatggaacgtgccggcgtctggccgacgcccctgaacttcgaactgtgg
attcactggctcggtgatcccgacggcgctctcggccaggaaatgacccggttgctcggc
gacggcacggccttcaccgacggcacggccgagatgctggcggctgaatatctgccgcgc
ggccgactgtccgaggaaatccgcgatgccggcgccgtcctgaaccgcgagttgtcgacg
gtttcggaggcgatcgccaaggcccagaaatcccaggccgcctatggccagaccctggcc
ggcgcttccgcccatctggaaagctccgccgaaccgtcggccctgctcggcgtcgtctcc
acgctctccagggccaccacgcaggtccaggccgagaatgccaccctggaaaaacggctg
gaaacctcgaccaaggaggtcgcccgacttcgcgagcacctggaacaggtccgccgcgac
gccatgacggacgccctgaccaacctcgccaaccgcaaggccttcgacgaagagctgctg
cgcgcctgcgacgaggccgagaagaagcgccagccgatgagcctcgcggtgctcgacatc
gaccatttcaagcgcttcaacgacacctggggccaccagaccggcgatcaggtcctgcgg
tatgtcgccagcgtcatcggccgcatctccaaggccccgcgcgtcgcggcccgctacggt
ggcgaagagttcgccatcatcttcccctccgaaagcgctgcgctggtggaagccgccctg
aaccagattcgggaagagatcggcagccgcgccctgcgccggcggtccaccaacgacgag
ctcggggccgtcaccatctccggcggtctggcccagcgccgccccggcgagaccggatcc
tcattgctcgaccgcgccgacgaggcgctctatgcgtccaaacgggccggccggaacaag
atcaccaacggtgagcgcctggaagaagccgcctga

DBGET integrated database retrieval system