KEGG   Brevundimonas subvibrioides: Bresu_2478Help
Entry
Bresu_2478        CDS       T01291                                 

Definition
dihydrofolate reductase region
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bsb  Brevundimonas subvibrioides
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bresu_2478
   00670 One carbon pool by folate
    Bresu_2478
Enzymes [BR:bsb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Bresu_2478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2492543..2493070
Genome map
AA seq 175 aa AA seqDB search
MPIPHIALVVARARNGVIGRDGDLPWKLRSDLQRFKQITLGKPCIMGRSTWESLPLRPLP
GRLNLVLSRDLSYEERGKAKGAVVCSNLADAIDMARETAEDDGIDEICVIGGTALFEAAL
PRAKRLYITEVEAEPEGDALFPAFDESLFAETLNERHDAGEKDDHPFVFRILDRI
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcccccatatcgccctcgtcgtcgcccgggcccgcaacggcgtcatcggtcgg
gacggcgacctgccgtggaagctgcgcagcgacctgcagcggttcaaacagatcaccctg
ggcaagccctgcataatggggcgctcgacgtgggagagcctgccgctgcggcccctgcct
ggccggctcaatctcgtgctgtcgcgcgacctgtcctacgaggagcggggcaaggccaag
ggggcggtcgtctgctccaacttggccgacgccatcgacatggcgcgcgagacggccgag
gacgacgggatcgacgagatctgcgtgatcggcggcacggccctgttcgaggccgccctg
ccccgcgcgaagcggctgtacatcaccgaggtcgaggccgagccggagggcgacgccctg
ttcccggcgttcgacgaatccctctttgccgagacgctgaacgaacggcatgatgccggc
gagaaggacgaccatccgttcgtcttccgcatcctggaccgcatctga

DBGET integrated database retrieval system