KEGG   Brevundimonas subvibrioides: Bresu_2563Help
Entry
Bresu_2563        CDS       T01291                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bsb  Brevundimonas subvibrioides
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsb00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Bresu_2563
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Bresu_2563
Enzymes [BR:bsb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Bresu_2563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2569416..2570264
Genome map
AA seq 282 aa AA seqDB search
MFQWPGKKDDEATERPVYRDPNDLKGQVAVISGSTSGIGLALARAVASRGGDVVLNGLGD
PSEIERTRAELEASCGVRVRYHAADMLKGDEVADMVAFAKHQLGRVDILVNNAGIQHVEA
VEKFPSDKWEQIIAINLSSTFYATRAAIPIMKAQGRGRIVNIASAHGLVASPFKSAYVAA
KHGVVGFTKTVALEVARDNITCNAICPGYVETPLVQSQIADQARARGISKEKVITDVILE
AQPTKQFVTTDQLSGLFLYLISDLGASANGAAFSIDGGWTAQ
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgttccagtggcccggcaagaaggatgacgaagcgaccgaacgtcccgtctatcgcgat
cccaacgacctgaagggtcaggtcgcggtcatttcgggctcgacctcgggcatcggactg
gccctggcgcgggccgtggcgtcgcgcggcggcgatgtggtgctgaacggcctgggggat
ccgtccgagatcgagcgtacgcgggctgagctggaagccagctgcggcgtgcgggtccgc
tatcacgccgccgacatgctgaagggcgacgaggtggccgacatggtcgccttcgccaag
caccagctgggccgggtcgacatcctggtgaacaacgccggcatccagcatgtggaggcg
gtcgagaaattcccgtccgacaagtgggaacagatcatcgccatcaacctgtcctcgacc
ttctatgccacccgcgccgccatcccgatcatgaaggcgcaaggccgcgggcggatcgtc
aacatcgcctcggcgcacggtctggtcgccagcccgttcaagtccgcctatgtcgccgcc
aagcacggcgtcgtcggcttcaccaagacggtggctctggaagtcgcgcgcgacaacatc
acctgcaacgccatctgcccgggctatgtcgagaccccgctggtccagtcccagatcgcc
gatcaggcgcgcgcgcgcggcatctcaaaggaaaaggtcatcaccgacgtgatcctggag
gcccagccgaccaagcagttcgtcaccaccgaccagctgtccggcctgttcctgtacctg
atctccgacctgggggcctcggccaacggggcggccttctcgatcgacggcggctggacc
gcgcaataa

DBGET integrated database retrieval system