KEGG   Brevundimonas subvibrioides: Bresu_2781Help
Entry
Bresu_2781        CDS       T01291                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bsb  Brevundimonas subvibrioides
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bsb00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Bresu_2781
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bresu_2781
Enzymes [BR:bsb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Bresu_2781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2802127..2803578)
Genome map
AA seq 483 aa AA seqDB search
MSAIRLSDLLRRDVAADPVITGVTADSRKVTSGSLFVALPGTAADGRAFIPQALSQGAAA
VLAPQDTPDGAAPLLVRSGDVRRAYALAARGFYGAQPATCVAVTGTNGKTSVAAFCRQIW
AALGIKAASMGTLGVVAQSGSITESLTPPGLTSPDAGDAARLLATLAEGGVTHLALEASS
HGIDQRRLDGVTLKAAAFTNLTQDHLDYHGDMAAYRAAKLRLFESLLPRGRTAVLNADSD
AYNAFAAASIMSGLGVMGVGERGRDLSLIERRAVPEGQRLILDVRGDRHDVLLPLAGAFQ
ASNALVAAGLCIAAGEDAARVLHALEKITGAAGRLQRVSGGRGEAYVDYAHTPDGLETVL
KALRPHATGRLIVVFGAGGDRDKGKRPLMGGIAGRLADVAIVTDDNPRSEDPAVIRAQVR
AGCPSAREVGDRRAAIREAVAMMRDGDVVVVAGKGHEQGQIVGGTTHPFDDATELAEALR
VDA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgatccgcctgtccgacctcctgcgccgcgacgtcgccgcggatcccgtgatc
accggcgtcacggcggacagccgcaaggtcacctcgggctccctgttcgtggccctgccg
ggcaccgccgccgacggccgcgccttcatcccccaggccctgtcgcagggggccgccgcc
gtgctcgccccccaggacacgcccgacggcgccgcgcccctgctggtccggtccggcgat
gtccgccgcgcctatgccctggccgcgcggggcttctacggcgcacagcccgcgacctgc
gtcgccgtcaccgggaccaacggcaagacctcggtcgccgccttctgccgccagatctgg
gccgccctcggcatcaaggcggccagcatgggcaccctcggggtcgtcgcccagtccgga
tcgatcaccgaaagcctgaccccgcccggcctgaccagccccgacgccggcgacgccgcc
cgcctgctggcgaccttggccgaggggggcgtcacccacctcgcgctcgaagcctcgtcg
cacggcatcgaccagcgccggctggatggcgtgacgctcaaggccgccgccttcaccaac
ctgacccaggaccacctcgactatcacggcgacatggcggcctatcgcgccgccaagctg
cggctgttcgagagcctcctgccgcgcggccggacggccgtgctcaacgccgattccgac
gcctacaacgccttcgccgccgcctcgatcatgtcgggcctgggcgtcatgggcgtgggc
gagcggggccgcgacctatccctgatcgagcgccgcgcggtgcccgagggccagcgcctg
atcctcgacgtgcgcggcgaccgccatgacgtcctcctgccgctggccggcgccttccag
gcctccaacgctcttgtcgccgcgggcctgtgcatcgccgccggcgaggacgccgcccgg
gtcctgcacgccctcgagaagatcaccggggccgccggccgcctgcagcgcgtgtccggc
ggtcggggcgaggcctatgtcgactacgcccacacccccgacgggctcgagacggtgctc
aaggcgctccgcccccacgccaccggccgcctgatcgtcgtcttcggcgcgggtggggat
cgcgacaagggcaagcggccgctgatgggtgggatcgccgggcggctggccgacgtcgcc
atcgtcaccgacgacaacccccggtcggaagaccccgcggtcatccgcgcccaggtccgc
gccggctgcccctcggcgcgggaggtcggcgaccgccgcgccgccatccgcgaggccgtc
gccatgatgcgcgacggggatgtggtcgtcgtcgccggaaaagggcatgaacagggtcag
atcgtgggcgggacgactcatcccttcgacgacgccaccgaacttgccgaggccctgcgc
gtagatgcctga

DBGET integrated database retrieval system