KEGG   Brevundimonas subvibrioides: Bresu_2881Help
Entry
Bresu_2881        CDS       T01291                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bsb  Brevundimonas subvibrioides
Pathway
bsb00010  Glycolysis / Gluconeogenesis
bsb00620  Pyruvate metabolism
bsb00640  Propanoate metabolism
bsb00680  Methane metabolism
bsb01100  Metabolic pathways
bsb01110  Biosynthesis of secondary metabolites
bsb01120  Microbial metabolism in diverse environments
bsb01130  Biosynthesis of antibiotics
bsb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bresu_2881
   00620 Pyruvate metabolism
    Bresu_2881
   00640 Propanoate metabolism
    Bresu_2881
  Energy metabolism
   00680 Methane metabolism
    Bresu_2881
Enzymes [BR:bsb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bresu_2881
Lipid biosynthesis proteins [BR:bsb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bresu_2881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADL02188
UniProt: D9QNF3
Position
2907784..2909721
Genome map
AA seq 645 aa AA seqDB search
MTDPDLYPVSAAWAERAHMDAAAYDAARIAARDTPDAFWAEQAKRLDWITAPTIIKDVSF
HKDDFRIRWFADGVLNVCFNCVDRHLPERADQTAIVWEGDDPAQSGQLTYAELHREVCRM
ANVLKALGVGKGDRVTIYLPMIPAAAVAMLACARIGAVHSVVFGGFSPDSIAGRIEDCGS
RFVITADEGLRAGKRIPLKANVDAALEKVAGVETVLIISHTHADVPMIAGRDVRYGEAKH
GVSDDCPCEPMGAEDPLFILYTSGSTGKPKGVLHTTGGYLFWVSYTHELVFDYRPGEVFW
CTADVGWVTGHSYVVYGALANAATTLMFEGVPNYPDNRRFWQVVDKHKVEIFYTAPTALR
ALMRDGDEPVKASSRASLRLLGTVGEPINPEAWRWYHEVVGEGRLPIIDTWWQTETGGAL
IAPLPGATDLKPGSATKPLPGVELELVDAEGGVLDGAASGNLCITDSWPGQMRTVWGDHQ
RFFDTYFSTYPGKYFTGDGCRRDKDGYYWITGRVDDVINVSGHRMGTAEVESALVLHDVV
AEAAVVGFPHDIKGQGIYAYVTLNAGVEPHDDLKAALVAHVRKEIGPIAAPDSIQWAPGL
PKTRSGKIMRRILRKIAENDLGSLGDTSTLADPSVVDDLVRNRGS
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcctgacctgtatccggtttccgccgcctgggcagaacgcgcccacatggac
gcggccgcctacgacgccgcccggatcgcggcgcgcgacacgcccgacgccttctgggcc
gaacaggcgaagcgcctcgactggatcacggcgccgacgatcatcaaggatgtctcgttc
cacaaggacgacttccgcatccgctggttcgccgacggggtcctgaacgtctgtttcaac
tgcgtcgatcgccacctgcccgagcgggccgaccagaccgccatcgtgtgggaaggcgat
gacccggcccagtccggacagctgacctatgccgagctgcaccgcgaggtgtgccgcatg
gccaatgtgctgaaggccctcggcgtcgggaagggcgaccgggtgacgatctatctgccc
atgatcccggcggcggccgtggcgatgctggcctgcgcgcgcatcggcgcggtccattcg
gtggtcttcggcggcttttcgccggatagcatcgccgggcggatcgaggactgcggctcc
cgtttcgtcatcaccgccgacgagggcctgcgcgccggcaagcgcatcccgctgaaggcc
aatgtcgatgcggccctggaaaaagtcgcgggggtggagaccgtcctgatcatcagccac
acccatgccgacgtgccgatgatcgccggccgtgacgtccgctacggcgaggcgaaacac
ggggtgtcggacgactgcccctgcgagccgatgggggccgaggaccctctgttcatcctc
tacacctcgggctcgaccggaaagcccaagggcgtgctgcacaccacgggcggctacctg
ttctgggtcagctacacgcacgaactggtgttcgactatcggcccggcgaggtcttctgg
tgcacggccgacgtcggctgggtcaccggccacagctacgtcgtctacggggccctggcc
aatgcggcgacgaccctgatgttcgagggcgtgcccaactatcccgacaaccggcgcttc
tggcaggtggtcgacaagcacaaggtcgagatcttctacaccgcccccacggccctgcgc
gccctgatgcgcgacggcgacgagccggtgaaggcctccagccgcgcctcgttgcgcctg
ctcggcacggtcggcgaacccatcaacccggaggcctggcgctggtatcacgaggtcgtc
ggcgagggccggttgccgatcatcgacacctggtggcagaccgagacgggcggggccctg
atcgcgcctctacccggcgcgaccgacctgaagcccggatcggccaccaagcccctgccg
ggcgtggagctggagctggtcgatgccgaaggcggggtgctggacggcgcggcctccggc
aacctgtgcatcaccgacagctggcccggccagatgcgcaccgtctggggcgatcatcag
cggttcttcgacacctatttctcgacctatcccgggaagtatttcaccggcgacggctgc
cggcgggacaaggacggctattactggatcaccggccgcgtcgacgacgtcatcaacgtc
tcgggccaccggatgggcacggccgaggtcgagagcgccctggtgctgcacgacgtcgtg
gccgaggcggccgtggtcggctttccccacgacatcaagggccagggcatctacgcctac
gtgacactcaacgccggggtcgaaccgcacgacgacctgaaggcggcgctggtcgcccat
gtccgcaaggaaatcggccccatcgccgcgcccgactcgatccagtgggcccccggcctg
cccaagacccgctccggcaagatcatgcggcggatcctgcgcaagatcgccgagaacgac
ctgggctcgctcggcgacacctcgacgctggcagacccgtccgtcgtggacgatctggtc
agaaatcggggtagctga

DBGET integrated database retrieval system