KEGG   Brevundimonas subvibrioides: Bresu_2909Help
Entry
Bresu_2909        CDS       T01291                                 

Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
bsb  Brevundimonas subvibrioides
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bsb00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2946462..2948858
Genome map
AA seq 798 aa AA seqDB search
MRKLTRALMLGTALLPSMACASMTPVTDPAVLPASEPIAPGAPGAATTWSSAAKTGVGAS
YEAYVDGHYRDGGPTGAVSKVWFSIADGVLTETMYGLIHEAQIKQMRFAVMTETGLSVEG
TDTTSRTEYQYVDAGGRPLSPAYRVITTDKAGRYEIAKTIFTDPDRNTLVVSVVIHALKG
PVTPYLVLEPHMANTGGGDIAEATNDVLFAHEGNVHLALMPSQPFEAASAGFLGASDGLM
DLQANGRLTNLYASSGGTPGSVVLTGAMQTIPEGLASAQAIYIGFGDSREAALASVRGSG
SSGETVGDLLARFNGEGDHVGWEDWIGSLTELPRMAEVGTDGGKLAYASALMLKVQEDRT
HAGALIASLSNPWGETVDATQASTGYKAVWPRDFYQVAMALMALGDRQTPLAAFRYLPQV
QVDAGTPGNTGATGWFLQKTHVDGQIEWVGVQLDQTAMPIMLGWKLWKAGEVSDAEMARM
YAAMIKPAADFLVDGGTIGLDWNDRTITPPWSQQERWEEQEGYSPSTTAAVITGLTVAAE
IARASGDVASADRYQATADDYAGKVEARMFTTEGSLGDGDYFLRLSRNEDPNDRAPLGEN
NGQPALPEDRIVDGGFLELVRYGVRAADAPSITETLPEYDDQTREDRLRVRYDLNGSSGW
RRYGNDGYGENTDTSGNYGVGGMTPGQRGRVWPIFTGERGTYELARLLEDGTPDPDAIDR
IRQTYVRGMESFANDGLLLPEQVWDGVGRTPADYAIGKGTDSATPLAWTHAEYLKLLRSL
ADRAIWDRYAPVATRYAR
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaactgacccgcgccctgatgctcggcaccgccttgctgccgtcgatggcctgc
gcctcgatgacgccggttaccgacccggctgtgctgcccgcgtccgagcccatcgccccc
ggggcccccggtgccgccacgacctggtcgagcgccgccaagaccggcgtcggggcctcg
tacgaagcctatgttgacggccattaccgggacggtggcccgacaggcgcggtgtcaaag
gtctggttctcgatcgccgacggcgttctcaccgagaccatgtacggcctgatccacgag
gcccagatcaagcagatgcggttcgccgtcatgacggagacgggcctgtccgtggaagga
accgacacgacgtcgcgcaccgaataccagtatgtcgatgccgggggccgtcccctgtcg
ccggcttaccgggtgatcacgaccgacaaggcgggccgctacgaaatcgcaaagaccatc
ttcaccgatcccgaccggaacaccctggtcgtgtcggtcgtgatccatgcccttaagggc
ccggtgacgccgtatctcgtgctggagccccacatggccaacacggggggcggcgacatc
gccgaggccaccaacgatgtattgttcgcccacgagggcaacgtgcacctggccctcatg
cccagccagcccttcgaagcggccagcgccggatttctgggggcatcggatggactgatg
gacctgcaggccaacggccgtctgaccaatctctacgcgtcatcgggcggcacgccggga
tcggtggtgttgaccggtgccatgcagacgatccccgagggactcgcctcggcccaggcc
atctacatcggctttggcgacagccgtgaggccgccctcgcctcggtgaggggttccgga
tcgtcgggcgagaccgtcggcgaccttctcgcccgcttcaacggcgagggcgatcatgtc
ggctgggaggactggatcggctccctgaccgaactgccccgcatggccgaggtcgggacc
gatggtggcaagctggcctatgcctcggcactgatgctgaaggtccaggaagatcgcacc
cacgccggagccctgatcgcgtccctctccaatccctggggcgaaacggtcgacgcgacc
caggcctcgaccggctacaaggccgtctggccgcgtgacttctatcaggtggccatggcc
ctgatggcgctgggagaccggcagacgcctctggcggccttccgctacctgccacaggtg
caggtcgacgcggggacacccggcaatacgggggccaccggctggttcctgcagaagacc
cacgtcgacggccagatcgaatgggtcggggtccaactggaccagacggccatgccgatc
atgctgggctggaagctgtggaaggcgggcgaggtgtccgacgccgagatggcgcgcatg
tatgccgccatgatcaagccggccgccgacttcctggtcgacggtggcaccatcggtctg
gactggaacgaccggacgatcaccccgccctggtcccagcaggagcgctgggaggaacag
gaaggctactcaccgtcgacgacggctgctgtcatcaccggactgacggtggcagcggag
atcgcgcgggcctccggggacgtcgcctccgccgaccgctatcaggcgaccgccgacgac
tatgccggcaaggtcgaggcacggatgttcacgacggaggggtcgctcggtgacggcgac
tatttcctgcgcctgagccgcaacgaagacccgaacgaccgcgcgcctctcggcgagaac
aacggccagcccgccctgccggaggaccggatcgtagacggcggcttcctggagctggtt
cgctatggcgtgcgggcggccgacgcgccctccatcacggagaccttgcctgaatacgac
gaccagacccgggaggatcgtctgcgcgtgcgctacgatctgaatggctcgtcgggctgg
cgtcggtacggcaacgacggctacggcgagaataccgacacctccgggaactatggggtg
ggcggcatgaccccgggtcagcgcggccgggtctggccgatcttcaccggcgagcgcggc
acctatgagctggcccgcctgctggaagacggtacgccggatcccgacgccatcgaccgc
atccgccagacctatgtgcgcggcatggaaagcttcgccaacgacggccttctcctgccc
gaacaggtctgggatggtgtgggtcgcacgccggccgactacgcgatcggcaaggggacg
gactcggcgacccccctcgcctggacccacgcggagtatctgaagctgctgcgatcgctg
gccgatcgcgctatctgggaccgctatgccccggtggcgacgcggtacgcccgatag

DBGET integrated database retrieval system