KEGG   Brevundimonas subvibrioides: Bresu_3056Help
Entry
Bresu_3056        CDS       T01291                                 

Definition
cytochrome C class I
Orthology
K08738  
cytochrome c
Organism
bsb  Brevundimonas subvibrioides
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bsb00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Bresu_3056
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bresu_3056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3131047..3131577
Genome map
AA seq 176 aa AA seqDB search
MRRFGIVSMVAASALLGLSACSGGGEDKAAAPAEQAAAPATAPVEAPAPAPATTPAAAPA
TAPAAGGATLQVAGLTGDAVAGERVFAQCRTCHSIEEGVNRVGPSLHGIIGRTAGQVAGY
NYSAANKASGKVWDNETLFAYLENPRAYIPGTKMAFVGLRDPQQRANVIAYLDTHD
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgttttggtatcgtgagcatggtggccgcaagtgccttgctcggactgtccgcc
tgctccggcggcggtgaggacaaagccgccgctcctgccgagcaggctgcagcccccgcg
actgctccggtcgaggcaccggctccggcgcctgcgacgaccccggctgccgcccccgcg
acggctccggccgctggcggcgcgacccttcaggtcgccggcctgaccggtgatgccgtg
gccggcgagcgcgtgttcgcccaatgccgcacctgccactcgatcgaggaaggcgtgaac
cgcgtcggtccgtccctgcacggcattatcggccggaccgctggtcaggtcgccggctac
aactattcggccgccaacaaggccagcggcaaggtctgggacaacgagaccctgttcgcc
tatctggaaaatccccgggcctacatccccggcaccaagatggccttcgtcggcctgcgt
gacccgcagcagcgcgccaacgtcatcgcctatctcgacacccacgactga

DBGET integrated database retrieval system