KEGG   Brevundimonas subvibrioides: Bresu_3105Help
Entry
Bresu_3105        CDS       T01291                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bsb  Brevundimonas subvibrioides
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bsb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bresu_3105
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bresu_3105
   00630 Glyoxylate and dicarboxylate metabolism
    Bresu_3105
Enzymes [BR:bsb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bresu_3105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3197438..3199570)
Genome map
AA seq 710 aa AA seqDB search
MTHHDRAGLSVDRQLSAFLEDEVLPGLGMAPDAFWTGVSGVFARFASENRALLARRDDLQ
ARIDAWHAARKGQPHDAAATEGFLREIGYLVDEPVPFQITTRNVDPELATLAGPQLVVPI
LNARFLLNAANARWGSLYDALYGTDALGDLPPPGGYDTARGARVVARAKAFLDEAVPLAE
GSHADVKGWSVVDGALVPALKEASQFVGYRGEPGAPGSILLARNGLHIELVIDRASAIGA
ADAAGLSDVVLESALSTICDLEDSVAAVDAEDKVAAYRNWLGLMKGDLAARFQKAGKTLE
RRLEPDRTFTAPAGGAVTLKGRSLLFVRNVGHLMTNPAIHLPDGTEAPEGILDAIVTSLI
ALYDLKGLGGFTNSAAGSVYIVKPKMHGPDEAAFTNALFDAVEDLLGLARHTIKVGVMDE
ERRTSANLAACIHAVKDRIVFINTGFLDRTGDEIHTAMQAGPMVRKADIKASKWIAAYEA
RNVAIGLACGLSGRAQIGKGMWAAPDRMADMLEQKIGHPRTGANTAWTPSPTAATLHALH
YHAVDVFAVQKEVATRPTPGLEDLLTPPLANGANWSEQEVADELDNNAQGILGYVVRWID
QGVGCSKVPDIDDIGLMEDRATLRISSQHIANWLLHGVCTGEQVDAAFLRMAAKVDAQNA
GDPLYRPMADDPEGSLAWQAARALVFEGLSQPNGYTEPLLHAFRLRAKAG
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgacccatcatgaccgcgccggcctgtcggtcgaccgacagctgtcggccttcctcgag
gacgaggtgctgccggggctgggcatggcgcccgacgccttctggaccggcgtgtccggg
gtcttcgcccggttcgcgtccgagaaccgggcgctgctggcgcggcgggacgatctgcag
gcccggatcgacgcctggcatgcggcccggaaaggccagccccacgatgcggcggccacg
gaaggcttcctgcgcgagatcggctatctggtcgacgagcctgttccgttccagatcacg
acccggaacgtcgacccggagctggcgaccctggccggaccgcaactggtggtgccgatc
ctcaatgcgcggttcctgctgaacgcggcgaacgcccggtggggcagcctgtacgacgcc
ctctatggcaccgacgcgctgggggatctgccgccaccgggtgggtatgacaccgcacgc
ggggcccgcgtcgtggcgcgggccaaggcgtttctggacgaggccgtgccgctggccgag
ggctcgcatgccgacgtcaagggatggtcggtcgtggacggggcgctggtgcccgcgctg
aaggaagcgtcgcagttcgtcggctaccgcggggagccgggggcaccgggttcgatcctg
ctggcccgcaacggactgcacatcgaactggttatcgaccgggcgagcgcgatcggggcg
gcggatgcagcgggcctgtcggacgtcgtgctggagagcgccctgtccaccatctgcgat
ctggaggactcggtcgccgccgtcgatgcggaggacaaggtcgccgcctatcgcaactgg
ctgggtctgatgaagggcgacctggccgcccgcttccagaaggccggcaagacgctggag
cggcgactggagccggaccggacgttcacggccccggccggaggggcggtgacgctgaag
ggacgctcgctgctgttcgtacgtaacgtcggccacctgatgaccaatccggcgatccat
ctgcccgacgggaccgaggcgcccgagggcattctcgatgcgatcgtgacgtcgctgatc
gccctgtacgacctcaagggtctgggcgggttcaccaactcggcggcggggtcggtctat
atcgtcaagcccaagatgcatgggccggacgaggctgccttcaccaacgccctgttcgac
gccgtcgaggacctgctgggactggcgcggcacacgatcaaggtcggggtgatggacgag
gaacggcggacctccgccaatctggccgcctgcatccacgcggtgaaggaccggatcgtc
ttcatcaacacgggtttcctcgaccgcaccggcgacgagatccacaccgccatgcaggcc
gggccgatggtccggaaggctgacatcaaggcctcgaaatggatcgcggcctatgaggcg
cgcaacgtcgccatcggcctggcctgcggcctgtcggggcgggcccagatcggcaagggc
atgtgggcggcgccggaccggatggccgacatgctggaacagaagatcggccatccccgc
acgggggcgaacaccgcctggacgccgagccccacggccgcgaccctgcatgcgctgcac
tatcacgcggtcgatgtcttcgccgtccagaaggaggtggcgacgcgccccacgccgggg
ctggaggatctgctgacgccgccgctcgcgaacggggcgaactggtcggagcaggaggtc
gccgacgagttggacaacaatgcccagggcatcctgggctatgtggtgcgctggatcgac
cagggcgtgggctgttccaaggtccccgacatcgatgacatcggcctgatggaggaccgg
gccacgctgcggatctcctcccagcatatcgccaactggctgctgcacggggtctgcacg
ggcgagcaggtggacgcggccttcctgcgcatggcggccaaggtcgatgcgcagaacgcg
ggcgatccgctctatcgtccgatggcggacgatcctgaaggatcactggcctggcaggcc
gcgcgggccctggtgttcgaggggctcagccagccgaacggctataccgagcccctgctt
cacgcgttccggctgagggcgaaggcgggttga

  All links  
No link information was found.   
DBGET integrated database retrieval system