KEGG   Brevundimonas subvibrioides: Bresu_3221Help
Entry
Bresu_3221        CDS       T01291                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bsb  Brevundimonas subvibrioides
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bsb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bresu_3221
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bresu_3221
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bresu_3221
Enzymes [BR:bsb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bresu_3221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3313353..3314183)
Genome map
AA seq 276 aa AA seqDB search
MTTSRIDARFAALKAEGRAGFVAYVMAGDPSRDEALAILRGLPAAGADIIELGFPFSDPM
AEGPPIQRAALRGLKAGLTLKGTLDLARAFREGDADTPLILMGYLNPIESYGYDAFARDA
AAAGVDGCIVVDCPPEEADPLTDALDAAQVSLIRLATPTSDDARLEVIARRTSGFVYYVS
VAGVTGVKEAQSASVAPAVERVRRASGLPVAVGFGVKTPERAAEIARVADAVVAGSVLVD
EVAAALDANEPVATRVLSKVKALADAVRGARVGETV
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctcccgcatcgacgcccgcttcgccgcgctgaaggccgagggccgggccggc
ttcgtcgcctatgtgatggccggcgacccctcgcgtgacgaggccctggcgatcctgcgc
ggcctgcccgccgccggggccgacattatcgaactgggctttccgttcagcgacccgatg
gccgagggtccgccgatccagcgcgcggcgctgcgcggcctcaaggccggcctgacgctg
aagggcacgctcgacctcgcccgggccttccgtgagggcgacgccgacacgcccctgatc
ctgatgggctatctgaacccgatcgagagctacggctacgacgccttcgcccgcgacgcg
gcggcggccggcgtcgacggctgtatcgtcgtcgactgtccgccggaagaggccgatccg
ctgacggacgccctggacgcggcgcaggtctccctgatccgcctggccacgccgacgtcc
gacgacgcccggctggaggtcatcgcgcggcggacctcgggcttcgtctattacgtctcc
gtcgccggcgtcacgggcgtaaaggaggcccagtcggcctccgtcgcgcccgccgtcgaa
cgcgtgcgccgcgcttcgggcctgcctgtcgccgtcggcttcggggtcaagacgccggaa
cgcgccgcagagatcgcccgtgtcgccgatgcggtcgtcgccggttcggtgctggtggat
gaggtcgccgccgccctcgacgcgaacgaaccggtcgcaacccgcgttctgtcgaaggtg
aaggccttggccgacgccgtgcgcggtgcacgcgtgggcgaaaccgtctaa

DBGET integrated database retrieval system