KEGG   Brevundimonas subvibrioides: Bresu_3223Help
Entry
Bresu_3223        CDS       T01291                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bsb  Brevundimonas subvibrioides
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bsb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bresu_3223
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bresu_3223
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bresu_3223
Enzymes [BR:bsb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bresu_3223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3314588..3315802)
Genome map
AA seq 404 aa AA seqDB search
MNAIIPNEYAMPDAEGRFGPYGGRFVAETLMPLVLELNHAYERCKADPTFQAELDDYLTH
YVGRPSPLYLAQRLTDHYGAANIWFKRDELNHTGAHKINNCMGQILLAMRMGKKRIIAET
GAGQHGVATATVCARFGLQCVVYMGAADVQRQSPNVFRMKLLGAEVIPVTSGRGTLKDAM
NEAMRDWVTNVEDTYYLIGTAAGPHPYPAMVRDFQSVIGKETKVQMQARRGKLPDAVVAA
IGGGSNAIGLFHPFIEDAGVRMIGIEAAGRGLDGPDHAASLQGGRPGVLHGNRTYLLQDA
DGQILEGHSISAGLDYPGIGPEHAWLKDMGRAEYRAATDAEALEAFQLCSKLEGIIPALE
PSHALARIGEIAAEIGTGGDVVLNMCGRGDKDIFAVAQHLGVEL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgccatcatccccaacgaatacgccatgcccgacgccgagggccggttcggcccc
tatggcggccggttcgtggccgagacgctgatgccgctcgtgctggagctgaaccacgcc
tatgagcggtgcaaggcggacccgaccttccaggccgagctggacgactatctgactcac
tacgtcgggcggcccagcccgctgtatctggcccagcgcctgaccgaccactacggggcc
gccaacatctggttcaagcgcgacgagctgaaccacacgggcgcgcacaagatcaacaac
tgcatgggccagatcctgctggccatgcggatgggcaagaagcggatcatcgcggaaacc
ggcgccggccagcacggcgtggccacggccactgtctgcgcccgcttcggcctgcaatgc
gtcgtctacatgggcgcggccgacgtccagcgtcagtcgcccaacgtgttccgcatgaag
ctgctgggggccgaggtcattccggtcacctcggggcgcggcacgctgaaggacgcgatg
aacgaggcgatgcgtgactgggtcaccaatgtcgaggacacctactacctcatcggtacg
gccgccggtccgcacccctatccggccatggtccgcgacttccagtcggtgatcggcaag
gagacgaaggtccagatgcaggcccggcgcggcaagctgccggacgccgtggtcgcggcc
atcggcgggggctccaacgccatcggcctgtttcatcccttcatcgaggatgcgggcgtc
cgcatgatcggtatcgaggcggccgggcgtgggctggacggccccgaccatgcggcctcg
ctgcagggcggccgccccggggtgctgcacggcaaccgcacctatctgctgcaggacgct
gacggccagatcctcgagggccactccatctcggccggcctcgactatcccggcatcggc
cccgagcacgcctggctcaaggatatgggccgggccgaataccgcgccgccaccgacgca
gaggccctggaggccttccagctgtgttcgaagctggaagggatcatccccgccctcgaa
cccagccacgccctggcgcgcatcggcgagatcgcggccgagatcggcaccggcggcgac
gtcgtgctgaacatgtgcgggcgcggcgacaaggatatcttcgcggtggcccagcacctg
ggtgtggagctctag

DBGET integrated database retrieval system