KEGG   Brevundimonas subvibrioides: Bresu_3223Help
Entry
Bresu_3223        CDS       T01291                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bsb  Brevundimonas subvibrioides
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bsb01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bsb00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bsb00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3314588..3315802)
Genome map
AA seq 404 aa AA seqDB search
MNAIIPNEYAMPDAEGRFGPYGGRFVAETLMPLVLELNHAYERCKADPTFQAELDDYLTH
YVGRPSPLYLAQRLTDHYGAANIWFKRDELNHTGAHKINNCMGQILLAMRMGKKRIIAET
GAGQHGVATATVCARFGLQCVVYMGAADVQRQSPNVFRMKLLGAEVIPVTSGRGTLKDAM
NEAMRDWVTNVEDTYYLIGTAAGPHPYPAMVRDFQSVIGKETKVQMQARRGKLPDAVVAA
IGGGSNAIGLFHPFIEDAGVRMIGIEAAGRGLDGPDHAASLQGGRPGVLHGNRTYLLQDA
DGQILEGHSISAGLDYPGIGPEHAWLKDMGRAEYRAATDAEALEAFQLCSKLEGIIPALE
PSHALARIGEIAAEIGTGGDVVLNMCGRGDKDIFAVAQHLGVEL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgccatcatccccaacgaatacgccatgcccgacgccgagggccggttcggcccc
tatggcggccggttcgtggccgagacgctgatgccgctcgtgctggagctgaaccacgcc
tatgagcggtgcaaggcggacccgaccttccaggccgagctggacgactatctgactcac
tacgtcgggcggcccagcccgctgtatctggcccagcgcctgaccgaccactacggggcc
gccaacatctggttcaagcgcgacgagctgaaccacacgggcgcgcacaagatcaacaac
tgcatgggccagatcctgctggccatgcggatgggcaagaagcggatcatcgcggaaacc
ggcgccggccagcacggcgtggccacggccactgtctgcgcccgcttcggcctgcaatgc
gtcgtctacatgggcgcggccgacgtccagcgtcagtcgcccaacgtgttccgcatgaag
ctgctgggggccgaggtcattccggtcacctcggggcgcggcacgctgaaggacgcgatg
aacgaggcgatgcgtgactgggtcaccaatgtcgaggacacctactacctcatcggtacg
gccgccggtccgcacccctatccggccatggtccgcgacttccagtcggtgatcggcaag
gagacgaaggtccagatgcaggcccggcgcggcaagctgccggacgccgtggtcgcggcc
atcggcgggggctccaacgccatcggcctgtttcatcccttcatcgaggatgcgggcgtc
cgcatgatcggtatcgaggcggccgggcgtgggctggacggccccgaccatgcggcctcg
ctgcagggcggccgccccggggtgctgcacggcaaccgcacctatctgctgcaggacgct
gacggccagatcctcgagggccactccatctcggccggcctcgactatcccggcatcggc
cccgagcacgcctggctcaaggatatgggccgggccgaataccgcgccgccaccgacgca
gaggccctggaggccttccagctgtgttcgaagctggaagggatcatccccgccctcgaa
cccagccacgccctggcgcgcatcggcgagatcgcggccgagatcggcaccggcggcgac
gtcgtgctgaacatgtgcgggcgcggcgacaaggatatcttcgcggtggcccagcacctg
ggtgtggagctctag

DBGET integrated database retrieval system