KEGG   Brevundimonas subvibrioides: Bresu_3232Help
Entry
Bresu_3232        CDS       T01291                                 

Definition
family 2 glycosyl transferase
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
bsb  Brevundimonas subvibrioides
Pathway
Metabolic pathways
Brite
Enzymes [BR:bsb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     Bresu_3232
Glycosyltransferases [BR:bsb01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   Bresu_3232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3321971..3322702)
Genome map
AA seq 243 aa AA seqDB search
MSSAATPDISVVVPVHNEAGAAGPLAREIAAAFAGRSYEMIFVDDASRDTTLAELRALGA
ELPALRVLAHQTNAGQSRAVRTGVLAARGTIIVTLDGDGQNPPADAPALVDALIAAPPQV
ALVGGVRQKRQDSEAKLWASRWANRIRKNLLGDDADDTGCGLKAFRRDVFLRLPYFDHIH
RYLPALVIREGFENRYLPISHRHRETGQSKYTNWGRLRASFTDLLGVMWLKSRSRRPGPV
TEF
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgccgcgacccccgacatctccgtcgtcgtccccgtccacaacgaggcgggc
gcggccggaccgctggcgcgcgagatcgcggccgccttcgccggacggtcctacgagatg
atcttcgtcgacgacgccagccgcgacaccaccctggccgaactgcgcgccctgggcgcc
gaactgccggccctgcgcgttttggcgcatcagaccaatgccggtcagagccgggccgtg
cgcaccggcgtccttgcggcacgggggacgatcatcgttaccctggacggcgatggccag
aacccgcccgccgatgcgcccgcccttgtcgacgccctgatcgccgccccgccgcaggtt
gccctcgtcggcggggtccgccagaagcgtcaggattccgaggccaagctgtgggcctcg
cgctgggccaaccgcatccgcaagaatctgctgggcgacgatgccgacgacacgggctgc
ggcctcaaggctttccgccgcgacgtcttcctgcggctcccgtatttcgatcacatccac
cgctacctgccggcgcttgtgatccgcgaggggttcgagaatcgctacctgcccatcagc
catcgccaccgcgagacgggccagtcgaaatacaccaactggggccggctgcgggcctcg
ttcaccgacctgctgggcgtcatgtggctgaagtcccgctcgcgcaggcccggcccggtc
acggaattctga

DBGET integrated database retrieval system