KEGG   Blastococcus saxobsidens: BLASA_0189Help
Entry
BLASA_0189        CDS       T01752                                 

Gene name
mutM
Definition
DNA-(Apurinic or apyrimidinic site) lyase; Formamidopyrimidine-DNA glycosylase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bsd  Blastococcus saxobsidens
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bsd03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
180008..180916
Genome map
AA seq 302 aa AA seqDB search
MPELPEVEALAAFLRERAVGHVLARADLAAVQAIKTFDPPLSALGGLEITGAGRHGKFLD
LDVSGVHLVVHLARAGWLHWRTNLPAAPPKPGKGPLALRVHLDDGATDPSASGGSTDLSA
SGGVGFDLTEQGTRKGLAVYVVRSPAEVPGIARLGPDALAVDRETFARLMAGRSGQLKGA
LTDQTLVAGIGNAYSDEILHAARLSPFKMADKLTDDELVRLFDAVRTTLTGALERQVGQQ
AATMKGEKRSGLRVHARTGLPCPVCGDTVREVSFADTSLQYCPTCQTGGKPLADRRMSKL
LR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgagttgcccgaggtggaggcgctggccgcgttcctgcgggagcgcgccgttggc
cacgtgctggcgcgcgccgacctggccgccgtccaggcgatcaagaccttcgacccaccg
ctgagcgcgctgggtggcctggagatcaccggcgccggccggcacgggaagttcctggac
ctcgacgtctccggggtgcacctggtcgtccacctggcgcgggccggctggctgcactgg
cggacgaacctccccgccgcgccgccgaagccgggcaagggtccgctcgcgctgcgggtg
cacctcgatgacggcgctacggatccatccgcctccggcggctctacggatctatccgcc
tccggcggagtgggcttcgacctcaccgagcagggcacccgcaagggcctggcggtctac
gtcgtccggtcgccggccgaggtccccgggatcgcccgcctcgggcccgacgccctcgcg
gtggaccgggagacgttcgcccgcctgatggccggccgctcgggccagctcaagggggcg
ctgaccgaccagaccctggtcgccggcatcggcaacgcctactccgacgagatcctgcac
gccgcgcggctctcgccgttcaagatggccgacaagctcaccgacgacgaactggtccgt
ctcttcgatgcggtgcggaccacgctcaccggagcactcgagcgccaggtggggcagcag
gccgcgacgatgaagggcgagaagcgctccggcctgcgggtgcacgcccgcaccggcctg
ccctgcccggtgtgcggggacaccgtgcgggaggtcagcttcgccgacacctcgctgcag
tactgccccacctgccagaccggcgggaagccgctggccgaccggcggatgtccaagctg
ctgcgctga

DBGET integrated database retrieval system