KEGG   Blastococcus saxobsidens: BLASA_0526Help
Entry
BLASA_0526        CDS       T01752                                 

Gene name
acsA
Definition
acetyl-coenzyme A synthetase (Acetate--CoA ligase) (Acyl-activating enzyme) (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bsd  Blastococcus saxobsidens
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bsd01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bsd00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bsd00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bsd00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bsd00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(512484..514433)
Genome map
AA seq 649 aa AA seqDB search
MSETPQVDGPTFAPPEDLAAQANLGPDAYEEAARDRLGFWASAAERLTWTQKWDTVLDWS
NPPFAKWFLGGTLNVAYNCVDRHVEAGHGDQVAYHWEGEPGDTRTITYAQLKDEVCKAAN
ALTEMGVQAGDRVAIYLPMIPEAVISMLACARIGAVHMVVFGGFSADALASRITDAGAQV
VITSDGGYRRGAPSALKPAVDEAVSRTEGVRKVLVVQRTEQDVDWDDSRDLWWHDVVDRQ
STEHEAQSFDAEHPLYIMYTSGTTAKPKGILHTSGGYLAQVSFTHWASFDLKADTDVFWT
AADVGWVTGHSYIVYGPLSNRATSVMYEGTPETPHRGRWFELIQKYGVTILYTAPTVIRT
FMKWGDEIPAGFDLSTLRLLGSVGEPINPEAWLWYHRNVGGGRCPIVDTWWQTETGGHMI
NPLPGVTTLVPGSAQRPFPGISAKVVDDEGKELENDSTGLLVLTEPWPSMLRTIWGDDDR
YVDTYWSRFGKNTYFAGDGAKKDADGHIWLLGRVDDVMNVSGHRISTTEVESSLVGHPAV
AEAAVVGATDPTTGQGIVAFVILRESGTDSGDELVQTLRTHVARDIGPIAKPRQIMVVQE
LPKTRSGKIMRRLLRDIAENRELGDVTTLTDSSVMNMIKDKLPAAPAED
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagacgccccaggtcgacggccccaccttcgccccgccggaggacctggcggcg
caggccaacctcgggccggacgcctacgaggaggccgcgcgcgaccggctggggttctgg
gcgtcggcagcggagcggctcacctggacgcagaagtgggacacggtcctggactggagc
aacccgcccttcgccaagtggttcctcggcggcacgctgaacgtcgcctacaactgcgtc
gaccggcacgtcgaggccggccacggcgaccaggtcgcctatcactgggagggcgagccg
ggcgacacccggacgatcacctacgcccagctgaaggacgaggtctgcaaggccgccaac
gccctcaccgagatgggcgtccaggccggtgaccgcgtggcgatctacctgccgatgatc
cccgaggccgtcatctcgatgctggcctgcgcccgcatcggcgccgtccacatggtggtc
ttcggcggcttctccgccgacgccctggccagccggatcaccgacgccggtgcgcaggtc
gtcatcacctccgacggcggttaccggcggggggcgcccagcgcgctcaagcccgccgtc
gacgaggcggtgtcccgcaccgagggcgtccggaaggtcctggtcgtccagcgcaccgag
caggacgtcgactgggatgacagccgcgacctgtggtggcacgacgtcgtcgaccgccag
tccaccgagcacgaggcgcagtccttcgacgccgagcacccgctctacatcatgtacacc
tcgggcacgacggcgaagcccaaggggatcctgcacaccagcggcgggtacctggcccag
gtcagcttcacccactgggcgagcttcgacctcaaggccgacaccgacgtcttctggacc
gccgccgacgtgggctgggtgaccggccacagctacatcgtctacggaccgctctccaac
cgggcgacgtctgtcatgtacgaggggacgccggagacaccgcaccgcggccgctggttc
gagctgatccagaagtacggcgtgacgatcctgtacaccgcaccgacggtcatccgcacc
ttcatgaagtggggcgacgagatcccggcgggcttcgatttgtcgacgctgcgcctgctc
ggctcggtcggcgagccgatcaaccccgaggcctggctctggtaccaccggaacgtcggc
ggcggacggtgcccgatcgtcgacacctggtggcagaccgagaccggcggccacatgatc
aacccgctacccggggtcacgaccctggtccccggctcggcccagcggcctttccccggc
atctccgccaaggtggtcgacgacgagggcaaggagctggagaacgactccaccgggctc
ctggtgctcaccgagccgtggccgtcgatgctgcgcaccatctggggcgacgacgaccgc
tacgtcgacacctactggtcgcggttcgggaagaacacctacttcgccggggacggcgcg
aagaaggacgccgacggccacatctggttgctcggccgggtcgacgacgtcatgaacgtg
tccggccaccgcatctcgaccaccgaggtggagtcctccctcgtcgggcacccggcggtg
gcggaggcggcggtcgtgggcgccaccgacccgaccaccggccagggcatcgtcgccttc
gtgatcctccgcgagagcggaacggactccggggacgagctggtgcagacgctgcgcacc
cacgtcgcccgcgacatcggcccgatcgccaagccccgccagatcatggtggtgcaggag
ctgccgaagacgcggtcgggcaagatcatgcgccggctgctgcgggacatcgccgagaac
cgcgagctgggcgacgtcaccacgctcaccgactcctcggtcatgaacatgatcaaggac
aagctgcccgccgcgcccgcggaggactga

DBGET integrated database retrieval system