KEGG   Blastococcus saxobsidens: BLASA_0577Help
Entry
BLASA_0577        CDS       T01752                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bsd  Blastococcus saxobsidens
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bsd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
560111..560728
Genome map
AA seq 205 aa AA seqDB search
MSEVPAEPADQLLEPVRGVDQQRAAAAVRELLLAIGEDPDRPGLRDTPDRVARAYAETFA
GLAQDPYDILATTFDEDHDELVLVKDIPMYSTCEHHLVPFHGVAHVAYIPGDDGRVTGLS
KLARLVEVYARRPQVQERMTRQIADALNDALKPRGALVVVQAEHLCMAMRGVRKPGSSTV
TSAVRGIFRENAATRSEAMSLVLGR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggtgcccgccgagccggccgaccagctgctggagccggtccgcggcgtcgac
cagcagcgggcggccgcggcggtgcgcgagctgctcctcgccatcggggaggaccccgac
cggcccggcctccgggacaccccggaccgggtcgcccgcgcgtacgcggagaccttcgcc
ggactcgcccaggacccgtacgacatcctcgcgacgacgttcgacgaggaccacgacgaa
ctggtgctggtcaaggacatcccgatgtactcgacctgcgagcatcacctcgtgcccttc
cacggggtcgcgcacgtggcctacatccccggcgacgacggtcgggtcaccgggctgtcc
aagctggcgcggctggtcgaggtctacgcccgccgcccccaggtccaggagcggatgacc
cggcagatcgccgacgccctgaacgacgccctcaagccacgcggcgcgctggtcgtcgtc
caggccgagcacctgtgcatggccatgcgcggggtgcgcaagcccgggtcctcgaccgtc
acctccgcggtccgcgggatcttccgggagaacgcggccacccgcagcgaggcgatgagt
ctggtgctcggccggtga

DBGET integrated database retrieval system