KEGG   Blastococcus saxobsidens: BLASA_0622Help
Entry
BLASA_0622        CDS       T01752                                 

Gene name
thrC
Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bsd  Blastococcus saxobsidens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLASA_0622 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLASA_0622 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BLASA_0622 (thrC)
Enzymes [BR:bsd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BLASA_0622 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
603179..604480
Genome map
AA seq 433 aa AA seqDB search
MTLTAPGSAQADSSAGGPVPPCPARGLVCRNCGATFGLIAEHACAECFGPLEVDYDPEVM
RAVTREQIEAGPQNIWRYAALLPVGQHPADRVSLDPGMTPLVRADRLAAELGLTGGLWVK
DDSANPTHSFKDRVVSLAATAAKGLGYRKIACASTGNLANSVAAHAARMGLPSYVFIPAD
LEPGKVVQSAVYGQTLVAVDGSYDDVNRLTSELAETDEFEDTAFVNQNVRPYYAEGSKTM
GYELAEQLGWRIPAQVVIPMASGSLLTKVDKAFRELVAAGIVEATEWTIFGAQSAGCDPI
ATAFDNGWDVVKPVKPTGIAKSLNIGNPADGPYALDAIRRTGGAVGRVGDDEIVQGIRDL
ARTTGVFAETAGGVTVAVLRQLVGNGRLDPAKETVVLNTGEGLKTLDPLEPVVGPTHRVE
PSLKSARAAGLIG
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgactctcaccgctcccggttccgcccaggccgactcgtctgccggcggtccggttccc
ccgtgcccggcccgcgggctggtctgccgcaactgcggcgccacgttcggcctgatcgcc
gagcacgcctgcgccgagtgcttcggcccgctggaggtcgactacgaccccgaggtgatg
cgtgcggtcacccgtgagcagatcgaggccgggccgcagaacatctggcgctatgcggcg
ctgctgccggtcggccagcacccggccgaccgggtgtccctcgacccgggcatgacgccg
ctggtccgcgccgaccggctggccgcggagctgggcctcaccggcggcctctgggtgaag
gacgactcggccaaccccacccactcgttcaaggaccgggtggtcagcctcgccgccacc
gccgccaaggggctgggctaccggaagatcgcctgcgcctccaccggcaacctggccaac
tccgtggccgcgcacgccgcccgcatggggctgccgtcctacgtgttcatccccgccgac
ctcgagccgggcaaggtcgtccagtccgcggtctacgggcagacgctggtcgccgtcgac
gggtcctacgacgacgtcaaccggctgaccagcgagctcgccgagaccgacgagttcgag
gacaccgccttcgtgaaccagaacgtccggccgtactacgccgagggctccaagacgatg
ggctacgagctcgccgagcagctcggctggcggatcccggcccaggtggtcatcccgatg
gcgtcgggctcgctgctgaccaaggtggacaaggcgttccgcgagctggtcgccgccggc
atcgtcgaggccaccgagtggaccatcttcggcgcgcagtcggccggctgcgacccgatc
gccaccgccttcgacaacggctgggacgtcgtcaagccggtgaagcccacgggcatcgcc
aagtcgctgaacatcggcaaccccgccgacggcccgtacgccctcgatgccatccgccgc
accggtggcgccgtgggccgggtgggggacgacgagatcgtccagggcatccgcgatctc
gcccgcaccaccggcgtcttcgccgagaccgccggcggtgtgaccgtcgccgtcctgcgc
cagctggtgggcaacgggcggctggacccggccaaggagaccgtcgtcctcaacaccggt
gagggcctcaagaccctcgacccgctggagccggtcgtcggcccgacccaccgggtcgag
ccgtcgctgaagtcggcgcgggcagccgggctcatcggctga

DBGET integrated database retrieval system