KEGG   Blastococcus saxobsidens: BLASA_0739Help
Entry
BLASA_0739        CDS       T01752                                 

Gene name
gtaB
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bsd  Blastococcus saxobsidens
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bsd00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bsd00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bsd00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bsd00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
708787..709707
Genome map
AA seq 306 aa AA seqDB search
MSISSSRPARKAVIPVAGMGTRFLPATKAVPKELLPVVDRPALQYIVEEAARAGLPEVLM
VTGRGKAAIEDFFDRTPELEAALEKKGDAARLAAVHESTEVAQVHFVRQGEAQGLGHAVL
QAAAFVGDEPFAVLLGDDLIDARDHLLEQMLAVQAEHGGSVIALLDVGRENIDKYGAVAV
EPTADGGDVVAVTGLVEKPPVEEAPSSLAIIGRYVLAPEIFEVLRETAPGRGGEIQLTDA
LATLVERGRPVHGVVFGGRRYDTGDKLDYLKAVVRLAAERDDLGPSFTAFLRDFVTELPA
EGASSS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatctccagcagccgtccggcccggaaggcggtcatccccgtcgcggggatgggc
acccggttcctgccggccaccaaggcggtgcccaaggagctgctcccggtcgtcgaccgg
ccggcactgcagtacatcgtcgaggaggccgcccgcgccggcctgcccgaggtcctcatg
gtcaccggccgcggcaaggcggcgatcgaggacttcttcgaccgcaccccggagctcgag
gcggcgctggagaagaagggtgacgccgcccgcctggcggccgtgcacgagtccaccgag
gtcgcgcaggtgcacttcgtgcgccagggggaggcccagggcctgggtcacgcggtgctg
caggcggccgccttcgtcggggacgagccgttcgcggtcctgctcggtgacgacctgatc
gacgcccgcgaccacctgctcgagcagatgctcgccgtccaggccgagcacggcggctcg
gtgatcgcgctgctcgacgtcggccgggagaacatcgacaagtacggcgccgtggccgtg
gagcccaccgccgacggcggcgacgtcgtcgcggtcaccggtctggtcgagaagccgccg
gtcgaggaggcacccagcagcctggcgatcatcggccgctacgtgttggcgccggagatc
ttcgaggtgctgcgggagaccgctcccggccgcggcggggagatccagctgaccgacgcg
ctcgccacgctggtcgagcgcggccgacccgtccacggggtggtcttcggcggtcgccgg
tacgacaccggggacaagctcgactacctcaaggcggtggtccggctcgccgcggagcgc
gacgacctggggccgtcgttcaccgcattcctgcgcgacttcgtcaccgagctgcccgcc
gagggcgcgtcgtcgtcctga

DBGET integrated database retrieval system