KEGG   Blastococcus saxobsidens: BLASA_0796Help
Entry
BLASA_0796        CDS       T01752                                 

Definition
putative Mg-chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bsd  Blastococcus saxobsidens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BLASA_0796
Enzymes [BR:bsd01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     BLASA_0796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(775672..777147)
Genome map
AA seq 491 aa AA seqDB search
MTDTTGATTAPASPSPAATTLGELRATGATFRPVKAELRANLLTRLAAGEATLPGMVGFE
DTVLPEVERALIAGHDLVLLGERGQGKTRLIRTLVGLLDEWTPVLTGSELNEHPLAPISV
WAHRQIAEHGDATPVGWLHRSDRFGEKLATPDTSVGDLIGDVDPIKVAEGRTLGDPETVH
YGLVPRTNRGIFSINELPDLAERIQVALLNVLEERDIQIRGYRVRLPLDLLLVASANPED
YTNRGRIITPLKDRFGAEVRTHYPIELADEIRLLQQEAALSWPTAFGADHLARPVVPQHL
VEIVARFTRLVRESSHVDTRSGVSARFAIAGLETVAASAVRRAAVAGETRPVARVVDLPS
IVPASRGKVEFADSGSDPDDDRELEVLEHLLRQATAQTFRARCAGLDLSGLQEHFTGGET
VESGDLVPAPALLGQLGTIPKLAELLGRLGVPEGDQSAEQAAAAVEFALEGLYLTRRLAK
DTDGGRTVYGA
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgacggacaccacgggtgccaccaccgcaccggcaagcccctcccccgcagccaccacc
ctcggcgagctccgcgccaccggcgccaccttccggccggtcaaggccgagctccgcgcc
aacctgctcacccgcctcgccgccggcgaggccaccctgcccggcatggtcggcttcgag
gacaccgtcctgcccgaggtcgagcgcgcactgatcgccggccacgacctggtgctcctc
ggcgagcgcgggcagggcaagacccggctgatccgcaccctcgtcggcctgctcgacgag
tggacgccggtgctcaccggcagcgagctcaacgagcacccgctggcgccgatcagcgtc
tgggcgcaccggcagatcgccgagcacggcgacgccaccccggtcggctggctgcaccgc
agcgaccggttcggcgagaagctggcgacaccggacacgagcgtgggcgacctgatcggc
gacgtcgacccgatcaaggtggccgagggccgcacgctgggcgacccggagacggtccac
tacggcctggtgccgcgcaccaaccgcggcatcttcagcatcaacgagctgcccgacctg
gccgagcggatccaggtggcgctgctcaacgtgctggaggagcgcgacatccagatccgc
gggtaccgggtgcggctgccgctggacctgctgctggtggccagcgcgaacccggaggac
tacaccaaccgcgggcggatcatcaccccgctcaaggaccggttcggcgccgaggtccgc
acgcactacccgatcgagctcgccgacgagatccggctgctgcagcaggaggcggcgctg
agctggccgaccgcgttcggcgccgaccacctggcgcgacccgtcgtcccccagcacctg
gtcgagatcgtcgcccgcttcacccggctggtccgcgagtccagccacgtcgacacccgc
tccggcgtcagcgcccggttcgccatcgccgggctggagaccgtcgccgcctccgccgtc
cgccgcgccgccgtcgccggcgagacccggccggtggcccgggtcgtcgacctgccgagc
atcgtcccggccagccgcggcaaggtcgagttcgccgactccggctccgacccggacgac
gaccgcgagctcgaggtgctcgagcacctgctccgccaggccaccgcgcagaccttccgc
gcccggtgcgcggggctggacctcagcggcctgcaggagcacttcaccggcggggagacc
gtcgagtccggcgacctggtgcccgccccggcgctgctcggccagctgggcacgatcccc
aagctcgccgagctgctcggccggctgggcgtgcccgagggcgaccagtcggccgagcag
gcggcggccgcggtggagttcgccctggaaggcctctacctcacccggcggctggccaag
gacaccgacggcggccgcaccgtctacggggcctga

DBGET integrated database retrieval system