KEGG   Blastococcus saxobsidens: BLASA_1036Help
Entry
BLASA_1036        CDS       T01752                                 

Gene name
recD
Definition
exodeoxyribonuclease V alpha chain (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bsd  Blastococcus saxobsidens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BLASA_1036 (recD)
Enzymes [BR:bsd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BLASA_1036 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
995798..997570
Genome map
AA seq 590 aa AA seqDB search
MIPVRVEGLLREFAEAGVLTAADVHVALRLARLGGEQRETVLLAAALAVRGVRAGSVCVE
LATVAESVVPDEDAPPVDLVWPQDWTALTDSPVVAVGADAPWRPLRLVDGLLYLDRYWQQ
EQLVRRELDERAARPAPPVDLTALPALFDGAAPDLQRLATAVVAGRWVSVITGGPGTGKT
HTVARLLKVLLDQPGPRPRIALAAPTGKAAARLQESVLEQAAAVGLPLDLTASTLHRLLG
WRPDSRSRFRHDATNRLPFDVVVVDESSMVSLTMMARLLEALRPTTRLVLVGDPDQLTPV
DAGAVLSDLVHRPAPPDAAATVPAEAADDGADLDDEARRQLRNGVVRLRVSQRYGPAIAG
LAEAVRTGDADRVLDLLDTGEGLALDAGTGAVEERIGTVAGEMRAAAERGDAAECLALLG
RHRLLCAHRHGPFGISAWNDRIGRLTGAMPGEWAPGLPLLVTANDHENELWNGDTGVVVR
TPDGVRAAFLRGTGPDLVPLSRLSAVGPAHALTVHRSQGSQFEEVAVLLPPASSPLLTRE
LLYTAVTRARRRVRVVGSAESVRAAVGRQVVRASGLRRASGPDRGSGGNT
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
gtgatcccggtccgggtcgaggggctgctgcgggagttcgccgaggccggtgtgctgacg
gccgccgacgtgcacgtcgccctgcgactcgcgcggctgggcggcgagcagcgggagacc
gtgctgctggccgcggcgctggcggtgcgcggtgtgcgcgccggctcggtgtgcgtggag
ctggccaccgtcgccgagtcggtggtacccgacgaggacgcgcctccggtcgacctcgtc
tggccgcaggactggacggcgctcaccgacagccccgtggtcgccgtcggcgccgacgcc
ccgtggcggccgctgcgcctggtcgacggcctgctctacctggaccgctactggcagcag
gagcagctggtccgccgggagctcgacgagcgcgctgcccggccggcgccaccggtggac
ctcaccgcgctgccggcgctgttcgacggcgccgcgccggacctgcagcggctggcgacg
gccgtggtcgccggccggtgggtcagcgtgatcaccggcgggccgggcaccggcaagacg
cacaccgtcgcccggctgctcaaggtgctgctcgaccagcccggcccgcggccccgcatc
gcgctggccgcgcccaccggcaaggccgccgcccggctgcaggagtcggtgctggagcag
gcggccgccgtgggcctgccgctggacctcaccgcatccacgctgcaccggctgctgggc
tggcggcccgacagtcgcagccggttccggcacgacgccaccaaccggctgcccttcgac
gtggtggtcgtggacgagtcgtcgatggtctcgctgacgatgatggcgcggctgctggag
gcgctccggccgaccacgcggctcgtgctcgtcggcgaccccgaccagctcacgccggtc
gacgccggcgccgtcctcagcgatctggtccaccgcccggcgccgccggatgccgcggcg
acggtgcccgcggaggcggccgacgacggcgccgacctggacgacgaggcgcgccggcag
ctgcgcaacggcgtcgtccggctgcgggtgtcccagcgctacggccccgccatcgccggc
ctggcggaggcggtgcgcacaggggacgccgaccgcgtcctcgacctgctcgacacggga
gaggggctcgcgctcgacgccggcaccggcgcggtggaggagcggatcggcacggtggcc
ggggagatgcgcgcggcggccgagcgcggggacgccgcggagtgcctcgcgctgctcggc
cggcaccggctgctgtgcgcgcaccggcacggcccgttcggcatctcggcgtggaacgac
cggatcggccggctcaccggcgccatgccgggggagtgggcgccggggctgccgctgctc
gtcaccgccaacgaccacgagaacgagctgtggaacggcgacacgggcgtcgtcgtccgg
actcccgacggcgtgcgggcggccttcctgcgggggaccggtcccgatctcgtgccgctc
tcccggctctccgcggtcggcccggcgcatgcgctgaccgtgcaccgcagccagggcagc
cagttcgaggaggtggccgtgctgctgccgccggcgtcctcaccgctgctcacccgggag
ctgctgtacacggccgtcacgcgggcccggcggcgggtccgggtcgtggggtcggcggag
tcggtgcgggcggcggtcggccgccaggtggtgcgtgccagcggtctgcgccgggcgagc
ggacccgaccgggggagcggcgggaacacctga

DBGET integrated database retrieval system