KEGG   Blastococcus saxobsidens: BLASA_1161Help
Entry
BLASA_1161        CDS       T01752                                 

Gene name
pncA
Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bsd  Blastococcus saxobsidens
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:bsd00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1106727..1107299)
Genome map
AA seq 190 aa AA seqDB search
MTRALIVVDVQNDFCEGGSLAVAGGAAVAAAVTEHIRTAGGEYAHVVATRDHHIDPGHHF
AAAPDFVETWPEHCVVGTGGAELHPALDRGPIEAVFDKGEYAAAYSGFEGAADGVPLARW
LQERGVDSVDVVGIATDHCVRATALDAVAEGFATRVLLPLTAGVAEGTVEAALDQLGTAG
VQLEGSVHGG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtgccctgatcgtcgtcgacgtgcagaacgacttctgcgaaggcggcagcctg
gccgtggccggcggcgccgcggtcgcggccgccgtcaccgagcacatccggacggcgggc
ggcgagtacgcgcatgtcgtcgcgacccgggaccaccacatcgacccggggcaccacttc
gccgcggcgcccgacttcgtcgagacctggcccgagcactgcgtcgtcggcaccggcggc
gccgagctgcaccccgcgctggaccgcggcccgatcgaggccgtgttcgacaagggcgag
tacgccgccgcctactcgggcttcgagggtgccgccgacggcgtccccctggcccggtgg
ctgcaggagcgcggggtcgattccgtcgacgtcgtcggcatcgcgaccgaccactgcgtg
cgcgcgaccgccctggacgccgtcgcggaggggttcgccacccgggtgctgctgccgctg
acggcgggcgtcgccgagggcacggtcgaggccgccctcgatcagctcgggacggcagga
gtccagctggagggctcggtgcacgggggctga

DBGET integrated database retrieval system