KEGG   Blastococcus saxobsidens: BLASA_1239Help
Entry
BLASA_1239        CDS       T01752                                 

Gene name
fadJ
Definition
fused enoyl-CoA hydratase and epimerase and isomerase ; 3-hydroxyacyl-CoA dehydrogenase (EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bsd  Blastococcus saxobsidens
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BLASA_1239 (fadJ)
   01212 Fatty acid metabolism
    BLASA_1239 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BLASA_1239 (fadJ)
   00650 Butanoate metabolism
    BLASA_1239 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    BLASA_1239 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    BLASA_1239 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BLASA_1239 (fadJ)
   00310 Lysine degradation
    BLASA_1239 (fadJ)
   00380 Tryptophan metabolism
    BLASA_1239 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BLASA_1239 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BLASA_1239 (fadJ)
   00281 Geraniol degradation
    BLASA_1239 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BLASA_1239 (fadJ)
Enzymes [BR:bsd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BLASA_1239 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BLASA_1239 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BLASA_1239 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1182793..1184955
Genome map
AA seq 720 aa AA seqDB search
MSDSTIRWESDADGVVVLTLDDPSSSANTMNDAYVRSMGETIDRLEREKGSIRGVVLTSA
KKTFFAGGNLGSLIQATPEMRGDVLAQVTRVKGQLRRLETLGIPVAAAVNGAALGGGLEI
ALACHHRVVLDDPKVKLGFPEVTLGLLPGGGGIVRSVRLLGLTTALLELLLQGQQVRSDK
ALELGLVHETAADRDELLAKARAWVLANEGAQQPYDVTGYQVPGGTPSSPSLAANLPAFP
ANLTKQLKGAPYPAPYAILSAAVESLQVDVDTAFTVEGRYFVDLVVGQISTNMIQALWFD
LNRINGGGSRPLVEETFVASKVGVLGAGMMGAGIAHAFAKVGVEVVLKDVGVEAAEKGRA
HVAGLVGKQVSRGRMSQEEADAFLARITATGDAADLAGCDVVVEAVFEDTALKHRVLSEA
EAHALPGALLASNTSTLPITGLAAGVQRPADVVGMHFFSPVDKMPLVELIVGERTSDAAL
ARAYDVVRQLGKTPIVVQDSRGFFTSRVFGTLVMEGAALLAEGVAPMSVERAALQAGFPA
GPLTLLDEVTLTLPLKIRDEAAQAGATDDHPGVAVLRMVVEHGRTGKSAGRGFFDWQPEK
RIWPGLTELFPTSDAVPFRDAQERLLFAMAVETARCVEEKVLNSVEDANIGSIMGIGFPP
LYGGVLQYVDQYAGGVAGFVARADELADTYGERFRPPAILLERAVPAGSLRASLSERASG
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacagcaccatccgctgggagtccgacgccgacggcgtcgtcgtcctcaccctc
gacgacccgtcgtcgtcggcgaacaccatgaacgacgcgtacgtgcggtccatgggtgag
accatcgaccggctggagcgcgagaagggctcgatccgcggggtcgtcctgaccagcgcg
aagaagaccttcttcgcgggcgggaacctgggcagcctgatccaggcgacgccggagatg
cggggcgacgtcctcgcgcaggtcacgcgggtgaagggccagctgcgccggctggagacc
ctgggcatcccggtcgcggcggccgtcaacggcgccgccctcggcgggggcctggagatc
gccctggcctgccaccaccgcgtcgtcctcgacgacccgaaggtcaagctgggcttcccc
gaggtgaccctcggcctgctgcccggtggcggcgggatcgtccgctcggtccggctgctc
ggcctgacgacggcgctgctcgagctgctcctccagggccagcaggtccgctccgacaag
gcgctggagctcggcctggtgcacgagaccgcggccgaccgcgacgagctgctggcgaag
gcacgcgcgtgggtgctggcgaatgagggcgcccagcagccctacgacgtgacgggctac
caggtgcccggcggtacgccgtcctcgccgtcgctggccgcgaacctgccggcgttcccg
gcgaacctgaccaagcagctcaagggcgcgccgtacccggcgccgtacgcgatcctctcg
gcggcggtggagagcctgcaggtcgacgtcgacaccgcgttcaccgtcgagggccgctat
ttcgtcgacctggtggtcggccagatctcgaccaacatgatccaggcgctgtggttcgac
ctgaaccggatcaacggtggcggctcccggccgctggtcgaggagacgttcgtggcgtcc
aaggtcggcgtgctcggcgccgggatgatgggcgccggcatcgcgcacgccttcgccaag
gtcggcgtcgaggtggtgctcaaggacgtgggcgtcgaggccgcggagaagggcagggcg
cacgtcgccgggctcgtcggcaagcaggtgtcgcgcggccgcatgtcccaggaggaggcc
gacgccttcctcgcccggatcaccgccaccggcgacgccgccgacctggccggctgcgac
gtggtcgtggaggcggtgttcgaggacaccgcgctcaagcaccgggtgctcagcgaggcc
gaggcccatgccctgccgggcgcgctgctggcctccaacacgagcacgctgccgatcacc
ggcctcgccgcgggggtgcagcggccggccgacgtcgtgggcatgcacttcttctcgccg
gtggacaagatgccgctggtcgagctgatcgtgggggagcggacgtccgacgccgcgctg
gcccgcgcctacgacgtcgtccggcagctcggcaagacgccgatcgtcgtccaggacagc
cggggcttcttcaccagccgggtcttcggcaccctggtcatggagggcgccgccctgctg
gccgagggcgtggcgccgatgagcgtcgagcgggccgcgttgcaggccggcttcccggcc
gggccgctcaccctgctcgacgaggtgacgctcaccctgcccctgaagatccgcgacgag
gcggcccaggccggcgccaccgacgaccacccgggggtcgccgtgcttcggatggtggtc
gagcacggccgcaccggcaagtccgccggccgggggttcttcgactggcagccggagaag
cggatctggcccgggctgaccgagctcttcccgaccagcgacgcggtgccgttccgcgac
gcccaggagcggctgctgttcgccatggcggtcgagacggcgcgctgcgtcgaggagaag
gtgctcaactcggtcgaggacgccaacatcggctcgatcatgggcatcgggttcccgccg
ctctacggcggcgtgctgcagtacgtcgaccagtacgcgggcggggtcgccgggttcgtg
gcccgggccgacgagctggccgacacctacggcgagcggttccggccaccggccatcctc
ctcgagcgggccgtccccgcgggcagcctgcgggcctcgctgtcggaaagggcatcgggc
tga

DBGET integrated database retrieval system