KEGG   Blastococcus saxobsidens: BLASA_1277Help
Entry
BLASA_1277        CDS       T01752                                 

Definition
acetyl/propionyl-CoA carboxylase subunit alpha (EC:6.3.4.14)
Orthology
K11263  
acetyl-/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.3.4.14]
Organism
bsd  Blastococcus saxobsidens
Pathway
Fatty acid biosynthesis
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BLASA_1277
  Lipid metabolism
   00061 Fatty acid biosynthesis
    BLASA_1277
Enzymes [BR:bsd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     BLASA_1277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1222389..1224389
Genome map
AA seq 666 aa AA seqDB search
MFDTVLVANRGEIAVRVIRTLREMGIRSVAVYSDADAGALHTRLADVAVRLGPAPAAQSY
LLVERVLAAAAETGAQAVHPGYGFLSENVEFARACESAGIVFIGPPVAAIEAMGDKIRAK
QTVMAAGVPVVPGRSEPGMSDEEVAEAAVAAGFPVLLKPSAGGGGKGMRVVRSKDELPDA
IAGARREARSSFGDDTLLVERYVGNSRHIEVQVLGDTHGTVIHLGERECSLQRRHQKVIE
EAPSPLLDTSMRASMGRAAVEAAKAVGYTGAGTVEFIVDADRPRDFFFLEMNTRLQVEHP
VTEAITGLDLVEQQIRVAAGERLPIDQSDVSLDGHAIEARLYAEDPARGFLPQAGTVLAL
IEPAGPGIRVDSSLAVGSVVGTDYDPMLAKVIAWGPDRETARARLVGALGRTAVLGVSTN
AAFLRALLTDEDVVAGRLDTGLIERRGNDLTAADPVPESVYASAALALQLEAEPTGPVVD
RFDVPDGWRLGEPAWTVRRLQAPGGEPVVIRLRGRAADAELCIGDGAPVPARAARYGDDL
VVTVGDWTARYAVVHVGGSVWLAADGRVTELREQERLASSAAGAAAGDGVVTSPMPGTVT
VVQASVGDEVEAGTPLLVVEAMKMEHVLTAPVAGTVAELGVTAGQTVALDERLALVMPKA
PDQQEL
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacaccgtcctggtcgccaaccgcggcgagatcgccgtccgggtgatccgcacg
ctgcgcgagatgggcatccggtcggtcgccgtctacagcgacgccgacgccggagcgctg
cacacccggctggccgacgtcgccgtccggctcggccccgcccctgcggcgcagagctac
ctgttggtcgagcgggtgctcgccgccgcggcggagacgggcgcccaggcggtccacccc
ggctacggcttcctgtcggagaacgtcgagttcgcccgggcgtgcgagtcggcggggatc
gtcttcatcggcccgccggtcgcggccatcgaggcgatgggcgacaagatccgcgccaag
cagaccgtgatggccgccggcgtcccggtcgtgccgggccggagcgagccggggatgagc
gacgaggaggtggccgaggccgccgtcgccgccggtttcccggtcctgctcaagccgagc
gcgggtggcggtggcaagggcatgcgcgtcgtgcggtcgaaggacgagctgcccgatgcg
atcgccggtgcgcggcgcgaggcgcgcagctcgttcggcgacgacacgctgctggtcgag
cgctacgtcggcaactcgcggcacatcgaggtgcaggtgctcggcgacacgcacgggacg
gtgatccacctcggtgagcgcgagtgcagcctgcagcgccggcaccagaaggtgatcgag
gaggcgccgtcgccgctgctggacacctcgatgcgggcgtcgatgggccgcgcggcggtc
gaggcggcgaaggcggtcggctacacgggcgcgggcacggtggagttcatcgtcgacgcc
gaccggccacgggacttcttcttcctggagatgaacacccggctccaggtcgagcacccg
gtcaccgaggccatcaccgggctggacctggtggagcagcagatccgggtggcggccggc
gagcggctgcccatcgaccagagcgacgtctcgctcgacgggcacgccatcgaggcgcgg
ctctacgccgaggacccggcccgcggtttcctgccgcaggccggcaccgtgctcgccctg
atcgagccggcgggccccggtatccgggtcgacagctcgctggccgtgggatccgtggtc
ggcaccgactacgacccgatgctcgccaaggtcatcgcctggggtcccgaccgggagacc
gcgcgggcccgcctcgtcggcgcgctcgggcgcaccgccgtcctcggcgtgagcaccaac
gccgcgttcctgcgcgcactgctcaccgacgaggacgtcgtcgccggccggctcgacacc
gggctgatcgagcgtcgcgggaacgacctcacggcggcggacccggtgccggagtcggtg
tacgcgtccgccgccctggcgctgcagctcgaggccgagcccaccggtccggtcgtcgac
cggttcgacgtgcccgacggctggcggctgggtgagccggcgtggaccgtgcggcgcctg
caggcgcccggtggcgaaccggtcgtgatccgcctgcgcggccgggctgccgatgccgag
ctgtgcatcggggacggcgccccggtgcccgcccgggcggctcggtacggggacgacctg
gtggtgaccgtcggcgactggacggcccgctacgcggtcgtgcacgtgggcggttcggtg
tggctggcggccgacgggcgggtcaccgagctgcgcgagcaggagcggctggcgtcgtcc
gcggcgggcgcggcggcgggtgacggcgtcgtcacctcgcccatgccgggcaccgtgacg
gtggtgcaggcctcggtcggggacgaggtggaggcgggcaccccgctgctcgtcgtcgag
gcgatgaagatggagcacgtgctcaccgccccggtcgcggggacggtggccgagctcggt
gtgacggcgggccagacggtcgcgctggacgagcggctggcgctggtgatgcccaaggcg
cccgatcaacaggagctctga

DBGET integrated database retrieval system