KEGG   Blastococcus saxobsidens: BLASA_1277Help
Entry
BLASA_1277        CDS       T01752                                 

Definition
(GenBank) Acetyl/propionyl-CoA carboxylase, alpha subunit
  KO
K11263  acetyl-CoA/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14]
Organism
bsd  Blastococcus saxobsidens
Pathway
bsd00061  Fatty acid biosynthesis
bsd00280  Valine, leucine and isoleucine degradation
bsd00620  Pyruvate metabolism
bsd00630  Glyoxylate and dicarboxylate metabolism
bsd00640  Propanoate metabolism
bsd01100  Metabolic pathways
bsd01110  Biosynthesis of secondary metabolites
bsd01120  Microbial metabolism in diverse environments
bsd01130  Biosynthesis of antibiotics
bsd01200  Carbon metabolism
bsd01212  Fatty acid metabolism
Module
bsd_M00082  Fatty acid biosynthesis, initiation
bsd_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BLASA_1277
   00630 Glyoxylate and dicarboxylate metabolism
    BLASA_1277
   00640 Propanoate metabolism
    BLASA_1277
  Lipid metabolism
   00061 Fatty acid biosynthesis
    BLASA_1277
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BLASA_1277
Enzymes [BR:bsd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     BLASA_1277
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BLASA_1277
    6.4.1.3  propionyl-CoA carboxylase
     BLASA_1277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl Dala_Dala_lig_C ATPgrasp_Ter ATP-grasp HlyD_3 Biotin_lipoyl_2 ATP-grasp_3 HlyD_D23 GCV_H NQRA ATP-grasp_4 DUF2118
Motif
Other DBs
NCBI-ProteinID: CCG02216
UniProt: H6RIM2
Position
1222389..1224389
Genome map
AA seq 666 aa AA seqDB search
MFDTVLVANRGEIAVRVIRTLREMGIRSVAVYSDADAGALHTRLADVAVRLGPAPAAQSY
LLVERVLAAAAETGAQAVHPGYGFLSENVEFARACESAGIVFIGPPVAAIEAMGDKIRAK
QTVMAAGVPVVPGRSEPGMSDEEVAEAAVAAGFPVLLKPSAGGGGKGMRVVRSKDELPDA
IAGARREARSSFGDDTLLVERYVGNSRHIEVQVLGDTHGTVIHLGERECSLQRRHQKVIE
EAPSPLLDTSMRASMGRAAVEAAKAVGYTGAGTVEFIVDADRPRDFFFLEMNTRLQVEHP
VTEAITGLDLVEQQIRVAAGERLPIDQSDVSLDGHAIEARLYAEDPARGFLPQAGTVLAL
IEPAGPGIRVDSSLAVGSVVGTDYDPMLAKVIAWGPDRETARARLVGALGRTAVLGVSTN
AAFLRALLTDEDVVAGRLDTGLIERRGNDLTAADPVPESVYASAALALQLEAEPTGPVVD
RFDVPDGWRLGEPAWTVRRLQAPGGEPVVIRLRGRAADAELCIGDGAPVPARAARYGDDL
VVTVGDWTARYAVVHVGGSVWLAADGRVTELREQERLASSAAGAAAGDGVVTSPMPGTVT
VVQASVGDEVEAGTPLLVVEAMKMEHVLTAPVAGTVAELGVTAGQTVALDERLALVMPKA
PDQQEL
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacaccgtcctggtcgccaaccgcggcgagatcgccgtccgggtgatccgcacg
ctgcgcgagatgggcatccggtcggtcgccgtctacagcgacgccgacgccggagcgctg
cacacccggctggccgacgtcgccgtccggctcggccccgcccctgcggcgcagagctac
ctgttggtcgagcgggtgctcgccgccgcggcggagacgggcgcccaggcggtccacccc
ggctacggcttcctgtcggagaacgtcgagttcgcccgggcgtgcgagtcggcggggatc
gtcttcatcggcccgccggtcgcggccatcgaggcgatgggcgacaagatccgcgccaag
cagaccgtgatggccgccggcgtcccggtcgtgccgggccggagcgagccggggatgagc
gacgaggaggtggccgaggccgccgtcgccgccggtttcccggtcctgctcaagccgagc
gcgggtggcggtggcaagggcatgcgcgtcgtgcggtcgaaggacgagctgcccgatgcg
atcgccggtgcgcggcgcgaggcgcgcagctcgttcggcgacgacacgctgctggtcgag
cgctacgtcggcaactcgcggcacatcgaggtgcaggtgctcggcgacacgcacgggacg
gtgatccacctcggtgagcgcgagtgcagcctgcagcgccggcaccagaaggtgatcgag
gaggcgccgtcgccgctgctggacacctcgatgcgggcgtcgatgggccgcgcggcggtc
gaggcggcgaaggcggtcggctacacgggcgcgggcacggtggagttcatcgtcgacgcc
gaccggccacgggacttcttcttcctggagatgaacacccggctccaggtcgagcacccg
gtcaccgaggccatcaccgggctggacctggtggagcagcagatccgggtggcggccggc
gagcggctgcccatcgaccagagcgacgtctcgctcgacgggcacgccatcgaggcgcgg
ctctacgccgaggacccggcccgcggtttcctgccgcaggccggcaccgtgctcgccctg
atcgagccggcgggccccggtatccgggtcgacagctcgctggccgtgggatccgtggtc
ggcaccgactacgacccgatgctcgccaaggtcatcgcctggggtcccgaccgggagacc
gcgcgggcccgcctcgtcggcgcgctcgggcgcaccgccgtcctcggcgtgagcaccaac
gccgcgttcctgcgcgcactgctcaccgacgaggacgtcgtcgccggccggctcgacacc
gggctgatcgagcgtcgcgggaacgacctcacggcggcggacccggtgccggagtcggtg
tacgcgtccgccgccctggcgctgcagctcgaggccgagcccaccggtccggtcgtcgac
cggttcgacgtgcccgacggctggcggctgggtgagccggcgtggaccgtgcggcgcctg
caggcgcccggtggcgaaccggtcgtgatccgcctgcgcggccgggctgccgatgccgag
ctgtgcatcggggacggcgccccggtgcccgcccgggcggctcggtacggggacgacctg
gtggtgaccgtcggcgactggacggcccgctacgcggtcgtgcacgtgggcggttcggtg
tggctggcggccgacgggcgggtcaccgagctgcgcgagcaggagcggctggcgtcgtcc
gcggcgggcgcggcggcgggtgacggcgtcgtcacctcgcccatgccgggcaccgtgacg
gtggtgcaggcctcggtcggggacgaggtggaggcgggcaccccgctgctcgtcgtcgag
gcgatgaagatggagcacgtgctcaccgccccggtcgcggggacggtggccgagctcggt
gtgacggcgggccagacggtcgcgctggacgagcggctggcgctggtgatgcccaaggcg
cccgatcaacaggagctctga

DBGET integrated database retrieval system