KEGG   Blastococcus saxobsidens: BLASA_1277Help
Entry
BLASA_1277        CDS       T01752                                 

Definition
acetyl/propionyl-CoA carboxylase subunit alpha (EC:6.3.4.14)
Orthology
K11263  
acetyl-/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14]
Organism
bsd  Blastococcus saxobsidens
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BLASA_1277
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BLASA_1277
   00640 Propanoate metabolism
    BLASA_1277
  Lipid metabolism
   00061 Fatty acid biosynthesis
    BLASA_1277
  Metabolism of terpenoids and polyketides
   00253 Tetracycline biosynthesis
    BLASA_1277
Enzymes [BR:bsd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     BLASA_1277
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BLASA_1277
    6.4.1.3  propionyl-CoA carboxylase
     BLASA_1277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1222389..1224389
Genome map
AA seq 666 aa AA seqDB search
MFDTVLVANRGEIAVRVIRTLREMGIRSVAVYSDADAGALHTRLADVAVRLGPAPAAQSY
LLVERVLAAAAETGAQAVHPGYGFLSENVEFARACESAGIVFIGPPVAAIEAMGDKIRAK
QTVMAAGVPVVPGRSEPGMSDEEVAEAAVAAGFPVLLKPSAGGGGKGMRVVRSKDELPDA
IAGARREARSSFGDDTLLVERYVGNSRHIEVQVLGDTHGTVIHLGERECSLQRRHQKVIE
EAPSPLLDTSMRASMGRAAVEAAKAVGYTGAGTVEFIVDADRPRDFFFLEMNTRLQVEHP
VTEAITGLDLVEQQIRVAAGERLPIDQSDVSLDGHAIEARLYAEDPARGFLPQAGTVLAL
IEPAGPGIRVDSSLAVGSVVGTDYDPMLAKVIAWGPDRETARARLVGALGRTAVLGVSTN
AAFLRALLTDEDVVAGRLDTGLIERRGNDLTAADPVPESVYASAALALQLEAEPTGPVVD
RFDVPDGWRLGEPAWTVRRLQAPGGEPVVIRLRGRAADAELCIGDGAPVPARAARYGDDL
VVTVGDWTARYAVVHVGGSVWLAADGRVTELREQERLASSAAGAAAGDGVVTSPMPGTVT
VVQASVGDEVEAGTPLLVVEAMKMEHVLTAPVAGTVAELGVTAGQTVALDERLALVMPKA
PDQQEL
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacaccgtcctggtcgccaaccgcggcgagatcgccgtccgggtgatccgcacg
ctgcgcgagatgggcatccggtcggtcgccgtctacagcgacgccgacgccggagcgctg
cacacccggctggccgacgtcgccgtccggctcggccccgcccctgcggcgcagagctac
ctgttggtcgagcgggtgctcgccgccgcggcggagacgggcgcccaggcggtccacccc
ggctacggcttcctgtcggagaacgtcgagttcgcccgggcgtgcgagtcggcggggatc
gtcttcatcggcccgccggtcgcggccatcgaggcgatgggcgacaagatccgcgccaag
cagaccgtgatggccgccggcgtcccggtcgtgccgggccggagcgagccggggatgagc
gacgaggaggtggccgaggccgccgtcgccgccggtttcccggtcctgctcaagccgagc
gcgggtggcggtggcaagggcatgcgcgtcgtgcggtcgaaggacgagctgcccgatgcg
atcgccggtgcgcggcgcgaggcgcgcagctcgttcggcgacgacacgctgctggtcgag
cgctacgtcggcaactcgcggcacatcgaggtgcaggtgctcggcgacacgcacgggacg
gtgatccacctcggtgagcgcgagtgcagcctgcagcgccggcaccagaaggtgatcgag
gaggcgccgtcgccgctgctggacacctcgatgcgggcgtcgatgggccgcgcggcggtc
gaggcggcgaaggcggtcggctacacgggcgcgggcacggtggagttcatcgtcgacgcc
gaccggccacgggacttcttcttcctggagatgaacacccggctccaggtcgagcacccg
gtcaccgaggccatcaccgggctggacctggtggagcagcagatccgggtggcggccggc
gagcggctgcccatcgaccagagcgacgtctcgctcgacgggcacgccatcgaggcgcgg
ctctacgccgaggacccggcccgcggtttcctgccgcaggccggcaccgtgctcgccctg
atcgagccggcgggccccggtatccgggtcgacagctcgctggccgtgggatccgtggtc
ggcaccgactacgacccgatgctcgccaaggtcatcgcctggggtcccgaccgggagacc
gcgcgggcccgcctcgtcggcgcgctcgggcgcaccgccgtcctcggcgtgagcaccaac
gccgcgttcctgcgcgcactgctcaccgacgaggacgtcgtcgccggccggctcgacacc
gggctgatcgagcgtcgcgggaacgacctcacggcggcggacccggtgccggagtcggtg
tacgcgtccgccgccctggcgctgcagctcgaggccgagcccaccggtccggtcgtcgac
cggttcgacgtgcccgacggctggcggctgggtgagccggcgtggaccgtgcggcgcctg
caggcgcccggtggcgaaccggtcgtgatccgcctgcgcggccgggctgccgatgccgag
ctgtgcatcggggacggcgccccggtgcccgcccgggcggctcggtacggggacgacctg
gtggtgaccgtcggcgactggacggcccgctacgcggtcgtgcacgtgggcggttcggtg
tggctggcggccgacgggcgggtcaccgagctgcgcgagcaggagcggctggcgtcgtcc
gcggcgggcgcggcggcgggtgacggcgtcgtcacctcgcccatgccgggcaccgtgacg
gtggtgcaggcctcggtcggggacgaggtggaggcgggcaccccgctgctcgtcgtcgag
gcgatgaagatggagcacgtgctcaccgccccggtcgcggggacggtggccgagctcggt
gtgacggcgggccagacggtcgcgctggacgagcggctggcgctggtgatgcccaaggcg
cccgatcaacaggagctctga

DBGET integrated database retrieval system