KEGG   Blastococcus saxobsidens: BLASA_1553Help
Entry
BLASA_1553        CDS       T01752                                 

Gene name
proB
Definition
(GenBank) gamma-glutamate kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bsd  Blastococcus saxobsidens
Pathway
bsd00330  Arginine and proline metabolism
bsd00332  Carbapenem biosynthesis
bsd01100  Metabolic pathways
bsd01130  Biosynthesis of antibiotics
bsd01230  Biosynthesis of amino acids
Module
bsd_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BLASA_1553 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BLASA_1553 (proB)
Enzymes [BR:bsd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BLASA_1553 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA SAM_2
Motif
Other DBs
NCBI-ProteinID: CCG02481
UniProt: H6RLF5
Position
1494625..1495761
Genome map
AA seq 378 aa AA seqDB search
MTGAPATTAARPEIAGAGRVVVKVGSSSLTTLPGGLDVERLTALVDVLAAVRASGREVVL
VSSGAIAAGLAPLGIDGRPRDLATAQAAASVGQLRLVQTYADAFARHGITVGQVLLTADD
LTRRSHYRNAHRTVERLLSLGVLPIVNENDTVATEEIRFGDNDRLAALVAHVAQAGALVL
LSDVDGVYDGDPRTGPAQLVDTVREPGDLAAVSLGSASRNGVGTGGMATKVEAAFIAAHA
GVPVVVTSTPQAADALAGNRVGTLFGAMGRRPSARQFWLRYASRPRGRLILDDGAVTAVR
ERHASLLAAGITGIAGDFLADDPVELVGPDGAVVARGLVAYDAREMPGLLGRKTGDLPPE
HRREVVHRDEMVLVGRLR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggtgcgcccgccaccaccgccgcccgcccggagatcgccggtgccgggcgggtc
gtggtcaaggtcggctcctcgtcgctgaccaccctgcccggcggtctggacgtcgagcgg
ctgacggcgctggtggacgtgctcgccgcggtgcgggcgtccggccgggaggtcgtgctg
gtgtcctccggcgcgatcgccgccggactggccccgctgggcatcgacgggcgcccgcgt
gacctggccaccgcgcaggcggcggccagcgtgggtcagctgcggctggtccagacctac
gccgacgccttcgcccggcacgggatcaccgtcgggcaggtgctgctcaccgccgacgac
ctgacccgtcgcagccactaccgcaacgcccaccggacggtcgagcggctgctgtcgctg
ggcgtgctgccgatcgtcaacgagaacgacacggtggccaccgaggagatccggttcggt
gacaacgaccggctggccgcgctggtggcgcacgtcgcccaggccggagcgctggtgctg
ctctccgacgtcgacggggtctacgacggcgacccgcgcaccggccccgcccagctggtc
gacacggtgcgcgagcccggcgacctcgcggcggtcagcctgggctcggccagccgcaac
ggcgtgggcaccgggggcatggccaccaaggtcgaggccgccttcatcgccgcgcacgcc
ggcgtccccgtggtggtcacctcgaccccgcaggccgccgacgcgctggccggcaaccgg
gtgggcacgttgttcggcgccatgggcaggcggcccagcgcccggcagttctggctgcgc
tacgccagccgtccgcgcggccggctgatcctcgacgacggtgcggtcaccgccgtgcgg
gagcggcacgcctccctgctggctgccggcatcaccggcatcgcgggggacttcctcgcc
gacgacccggtcgagctggtcgggcccgacggtgcggtggtggcccgtgggctggtcgcc
tacgacgcccgcgagatgccgggcctcctcggccgcaagaccggcgacctgccgccggag
caccgccgcgaggtggtgcaccgcgacgagatggtgctggtcggacgcctgcgctga

DBGET integrated database retrieval system