KEGG   Blastococcus saxobsidens: BLASA_2088Help
Entry
BLASA_2088        CDS       T01752                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bsd  Blastococcus saxobsidens
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BLASA_2088 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BLASA_2088 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BLASA_2088 (sucB)
Enzymes [BR:bsd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BLASA_2088 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1991710..1993578)
Genome map
AA seq 622 aa AA seqDB search
MPTSVTMPALGESVTEGTVTRWLKQEGEQVEVDEPLLEVSTDKVDTEIPSPAAGVLTKIL
VAEDETVEVGAELAVIGGDGDDGGDAAPPASAEDADTTPQTPDQQVEDADLGSAEPEQPA
EQQEEPAPAAADSGSEGGGGGSEGGGGGGGEGTPVTMPALGESVTEGTVTRWLKAVGEEV
TADEPLLEVSTDKVDTEIPAPVSGTLLEITVNEDETVDVGAQLAVIGSGAAGGGSAPAPA
PQQEAPEEAPAAPEPQAAPEAKQATTETAQPGGDYGASGAQPAASPTSAPAPRVAPQAPS
APAPSGDGGGSQYVTPLVRRLAAEHGVDLNSVSGTGVGGRIRKQDVLAAAEKSAAPAESA
PAPSSSGGTRTPSPAATPDTSVRGRTEKLSRLRTVIAKRMVESLQVSAQLTTVVEADVTR
IAQLRQQAKGGFEAREGVKLSFLPFFAKAAVEALKQHPSVNASIDLEGGTVTYHDAENLG
VAVDTERGLLVPVIHGAGDLSIGGLARKINDLAERTRTNKVTPDELGGGTFTLTNTGSRG
ALFDTPIINQPQVAILGTGSVVKRPVVVQDAELGEVIAVRSMIYLALTYDHRIVDGADAA
RFLTTVRERLEAGQFHGELGLS
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgccgacctccgtcaccatgcccgccctgggcgagagcgtcaccgagggcacggtcacc
cgctggctcaagcaggagggtgagcaggtcgaggtcgacgagcccctcctcgaggtctcg
accgacaaggtcgacaccgagatcccgtcgccggccgccggcgtgctgaccaagatcctg
gtggccgaggacgagaccgtggaggtcggcgcggagctggccgtcataggtggggacggc
gacgacggtggcgacgccgccccgcccgcctccgccgaggacgccgacaccacaccgcag
acgcctgaccagcaggtggaggacgccgacctcggttccgcggagccggagcagcccgcg
gagcagcaggaggagcccgccccggcagcggccgacagcggctccgaggggggcggcggc
ggctccgaaggtggcggcggcggtggcggtgagggcaccccggtcaccatgccggcgctc
ggcgagagcgtcaccgagggcaccgtcacccgctggctcaaggccgtgggcgaggaggtg
accgccgacgagccgctgctcgaggtctccaccgacaaggtggacaccgagatccccgct
ccggtcagcggcaccctcctcgagatcacggtcaacgaggacgagaccgtcgacgtcggc
gcccagctcgccgtcatcggcagcggtgccgccggcggcggctccgcccccgccccggca
ccgcagcaggaggccccggaggaggctcctgccgctccggagccccaggccgccccggag
gccaagcaggccacgaccgagacggcgcagcccggtggggactacggcgccagcggcgcc
cagccggccgcctcgccgacgtccgcaccggcgccccgggtggctccccaggcaccgtcc
gcccccgccccgtcgggcgacggcggcggcagccagtacgtcacgccgctggtgcgccgt
ctggccgccgagcacggtgtcgacctgaactccgtctcgggtaccggcgtcggtggccgg
atccgcaagcaggacgtgctcgcggcggcggagaagtccgccgccccggccgagtccgcc
ccggcaccgtcgagctcgggcggcacccggaccccgtccccggcggccacgccggacacg
tcggtccgcggccgcacggagaagctgtcccgtctccgcacggtcatcgccaagcggatg
gtcgagtcgctgcaggtgagcgcgcagctgaccaccgtcgtggaggccgatgtcacccgc
atcgcgcagctgcggcagcaggcgaagggcggcttcgaggctcgcgagggcgtgaagctg
tcgttcctgccgttcttcgcgaaggccgccgtcgaggcgctcaagcagcacccgtcggtg
aatgcgtcgatcgacctcgagggcggcacggtcacctaccacgacgcggagaacctcggg
gtggccgtcgacaccgagcggggcctgctggtcccggtgatccacggcgccggcgacctg
agcatcggtgggctcgcccgcaagatcaatgacctggccgagcgcacccgcacgaacaag
gtgacgcccgacgagctgggcgggggcacgttcacgctgaccaacaccggcagccgcggc
gcgctcttcgacacgccgatcatcaaccagccgcaggtggccatcctgggcaccggctcg
gtggtgaagcgcccggtcgtcgtccaggacgccgagctgggcgaggtgatcgcggtccgg
tcgatgatctacctggccctcacctacgaccaccggatcgtcgacggtgccgacgccgcc
cgcttcctcaccacggtgcgggaacggctcgaggccggccagttccacggggagctcggc
ctctcctga

DBGET integrated database retrieval system