KEGG   Blastococcus saxobsidens: BLASA_2127Help
Entry
BLASA_2127        CDS       T01752                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bsd  Blastococcus saxobsidens
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BLASA_2127 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLASA_2127 (glcK)
   00052 Galactose metabolism
    BLASA_2127 (glcK)
   00500 Starch and sucrose metabolism
    BLASA_2127 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    BLASA_2127 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BLASA_2127 (glcK)
   00524 Butirosin and neomycin biosynthesis
    BLASA_2127 (glcK)
Enzymes [BR:bsd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BLASA_2127 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2027544..2028533
Genome map
AA seq 329 aa AA seqDB search
MTEPDGTARPALGIDIGGTKVAGGLVAPDGTILATARRGTPGASVRETEDAIVAVVEELA
DGHPGELVGVGVGAAGWFDRTGDTVLFSPHLAWRNSTLRRDLGARLQRPLWVGNDADAAA
WAEYRYGAARGADLALMITLGTGIGGGIVLDGRLRRGSHGVAGEWGHMRVVPDGRLCACG
NRGCWEQYASGTALGQTAREVARTSPAAAAVLLERVDCEPDRLTGEHVARAAYDGDPLAL
ELVTEVGCWLGQGIADLAAVLDPEVVVIGGGVSVLGEMVLGPARERLDRALPGRGFRPGP
RIVAAALGAQAGIVGAADLVRRAVAEGEA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagccagacggaacggcgcggccggcgctcggcatcgacatcggtggcaccaag
gtcgcgggcgggctggtcgcaccggacggcacgatcctggccaccgcccggcgcggtacg
cccggggcgtcggtgcgcgagaccgaggacgccatcgtcgccgtcgtcgaagagctggcg
gacgggcacccgggcgagctcgtcggggtcggcgtcggcgccgccggctggttcgaccgg
acgggcgacacggtcctgttcagcccgcacctggcgtggcggaactcgacgctgcgcagg
gacctcggcgcccggctgcagcgaccgctctgggtcggcaacgacgccgacgccgccgcc
tgggcggagtaccgctacggagcggcgcggggcgccgacctggcgctgatgatcaccctc
ggaaccgggatcggcgggggcatcgtcctcgacggccggctgcgccgcgggtcgcacggc
gtcgcaggggagtgggggcacatgcgcgtggtccccgacggccggctgtgcgcgtgcggc
aaccgcggctgctgggagcagtacgccagcggcacggcgctgggccagaccgcccgcgag
gtcgcccgcacctcaccggccgcggccgcggtgctcctggagcgggtggactgcgagccg
gaccggctcaccggtgagcacgtggcccgcgccgcctacgacggcgacccgctggcgctg
gaactggtgaccgaggtgggctgctggctcgggcagggcatcgccgacctcgccgccgtg
ctcgaccccgaggtggtcgtgatcggcggcggggtgagcgtgctgggcgagatggtgctg
ggcccggcccgcgagcggctggaccgcgcactgcccggccgcggattccgccccgggccg
cgcatcgtcgccgccgcactcggagcccaggccggcatcgtgggcgccgccgacctggtc
aggcgcgccgtcgccgagggcgaggcctag

DBGET integrated database retrieval system