KEGG   Blastococcus saxobsidens: BLASA_2130Help
Entry
BLASA_2130        CDS       T01752                                 

Definition
Thermostable monoacylglycerol lipase (EC:3.1.1.23)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bsd  Blastococcus saxobsidens
Brite
Enzymes [BR:bsd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BLASA_2130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2030685..2031503)
Genome map
AA seq 272 aa AA seqDB search
MPGPTPAAEVMAGAEPFSFPGGPGPEGRTGVLLVHGFTGTPMSMRPWGEALAAEGFAVRC
PLLPGHGTRWQDCNTCTHDQWTATVEGAFDELAAGCDRVFVAGLSMGGTLATRLAEVRPD
DVAGLLLVNPALLTQRLDAKLLPLLARVTPSWAPIASDIRKSGVTELAYRKLPTRAMMQL
RGLWAATRADLGRVTAPVVVFRSVEDHVVEPVNSTILLAGVGSADTTEVLLENSFHVATL
DNDAPLIFARSAEWIRERVPADQPDVSAADRR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgcccggaccgacccctgccgccgaggtcatggccggtgcggagccgttctccttcccg
ggcggtcccgggcccgagggccgcaccggggtcctgctggtgcacgggttcacggggacg
ccgatgagcatgcggccctggggcgaggccctggccgccgagggtttcgcggtgcggtgc
ccgttgctgcccggccacggcacccgctggcaggactgcaacacctgcacccacgaccag
tggacggcgaccgtcgagggcgccttcgacgagctcgccgccggctgcgaccgcgtgttc
gtggccggcctctcgatgggtggcacgctcgccacccggctggccgaggtccggcccgac
gacgtcgccggcctgctgctggtgaaccccgctctgctgacccagcggctggatgccaag
ctgctgcccctgctggcgcgcgtcacgcccagctgggcgccgatcgccagcgacatcagg
aagtccggcgtcaccgagctggcctaccgcaagctgccgacccgcgcgatgatgcagctc
cgcggcctctgggccgcgacccgggcggacctgggccgggtcaccgcacccgtggtcgtc
ttccgcagcgtggaggaccacgtcgtggagccggtcaacagcaccatcctgctcgccggc
gtgggcagcgcggacaccaccgaggtgctgctcgagaacagcttccacgtggccaccctc
gacaacgacgccccgctgatcttcgcccggtccgcggagtggatccgcgagcgcgtcccg
gccgaccagcccgacgtgtccgcggcggaccgccgatga

DBGET integrated database retrieval system