KEGG   Blastococcus saxobsidens: BLASA_2141Help
Entry
BLASA_2141        CDS       T01752                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bsd  Blastococcus saxobsidens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BLASA_2141 (pfkA)
   01230 Biosynthesis of amino acids
    BLASA_2141 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLASA_2141 (pfkA)
   00030 Pentose phosphate pathway
    BLASA_2141 (pfkA)
   00051 Fructose and mannose metabolism
    BLASA_2141 (pfkA)
   00052 Galactose metabolism
    BLASA_2141 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BLASA_2141 (pfkA)
Enzymes [BR:bsd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BLASA_2141 (pfkA)
Protein phosphatases and associated proteins [BR:bsd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BLASA_2141 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2043268..2044293
Genome map
AA seq 341 aa AA seqDB search
MRIGILTGGGDCPGLNAVIRAVVRKGVTEYGDEIVGFRDGWRGVLDGDTVPVDLAAVRGL
LPRGGTVLGTSRTNPYSVEGGPERVRETLGRLGIDALVPIGGEDTLGVATRLAETGVRMV
GVPKTIDNDLDATDYTFGFDTAVGVAMEAIDRLHTTGDSHHRTLVVEVMGRHAGWIALHA
GMAGGASVVLIPEHPFDVDGVVAHCLHRFESGYSPIVVVSEGATPRDGDLMLSTGDEDAF
GHVRLGGIGPALAALIEERTGRESRAVVLGHVQRGGTPSPFDRVLATRFGLAAVDAVHAG
ESGVMVALRGTDIVRVPLSTATAQLKLVPPERYAEAEVFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggcatcctcaccggcggaggcgactgcccggggctgaacgccgtcatccgc
gccgtggtgcgcaagggggtgaccgagtacggggacgagatcgtcggcttccgcgacggc
tggcgcggggtgctcgacggcgacaccgtcccggtggacctcgccgcggtgcgcggcctg
ctgccccgtggcggcaccgtgctcggcacctcccgcaccaacccgtactccgtcgaaggc
gggccggagcgggtgcgggagaccctcgggcggctcgggatcgacgcgctcgtgccgatc
ggcggggaggacaccctgggggtggccacccggctggccgagaccggggtgcggatggtg
ggcgtgccgaagaccatcgacaacgacctggacgccaccgactacacgttcggcttcgac
accgccgtcggcgtggccatggaggccatcgaccggctgcacaccaccggggacagccac
caccgcacgctcgtcgtcgaggtcatggggcggcacgcgggctggatcgcgctgcacgcg
ggcatggccggcggggccagcgtcgtcctcatcccggagcacccgttcgacgtcgacggc
gtcgtcgcgcactgcctgcaccgcttcgagtcggggtactcgccgatcgtggtcgtctcg
gagggggccacgccgagggacggcgacctgatgctctcgacgggggacgaggacgcgttc
ggccacgtccggctgggtggcatcggcccggccctggcggcgctgatcgaggagcgcacc
ggccgggaatcgcgggccgtcgtcctcgggcacgtgcagcgcggcggcacgccgtcgccc
ttcgaccgggtgctggccacccggttcggcctggctgccgtggacgcggtgcacgccggg
gagagcggggtgatggtcgccctgcgcggcaccgacatcgtccgcgtacccctgtcgacg
gctacggcgcagctcaagctggtgccgcccgagcggtacgccgaagcggaggtgttcttc
ggctga

DBGET integrated database retrieval system