KEGG   Blastococcus saxobsidens: BLASA_2277Help
Entry
BLASA_2277        CDS       T01752                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bsd  Blastococcus saxobsidens
Pathway
bsd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsd01100  Metabolic pathways
bsd01110  Biosynthesis of secondary metabolites
bsd01130  Biosynthesis of antibiotics
bsd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLASA_2277 (trpC)
Enzymes [BR:bsd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BLASA_2277 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh OMPdecase
Motif
Other DBs
NCBI-ProteinID: CCG03183
UniProt: H6RUL6
Position
2177887..2178696
Genome map
AA seq 269 aa AA seqDB search
MNVLDEIVTGVRTDLAVREAATPLDRIKAAAQAARPAHDALAALRAPGVGVIAEVKRRSP
SKGDLADIADPASLAQQYAAGGARVISVLTEGRRFGGSHADLAAVRAVVDVPVLCKDFIV
SSYQVHEARAYGADVVLLIVAALEQNVLVGLLERVESLGMTALVEVHTEAEADRALAAGA
SVIGVNARDLTTLQVDRSTFEKIAPGLPSEVVKVAESGVRGPHDLISYAAAGADAVLVGE
GLVTAGDARQAVADLVTAGSHPATPRTTR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgtgctcgacgagatcgtgaccggcgtccgcaccgacctcgccgtgcgcgaggcc
gctacgccgctcgaccggatcaaagcggcggcgcaggccgcccggccggcgcacgacgcc
ctggccgccctgcgggcccctggcgtcggggtcatcgccgaggtcaagcgccgcagcccg
tccaagggcgacctggccgacatcgccgatccggcgtcgttggcccagcagtacgccgcc
ggtggcgcacgggtgatctcggtgctcaccgagggacgccgcttcgggggatcgcacgcc
gacctggccgcggtccgggcggtggtcgacgtcccggtgctgtgcaaggacttcatcgtc
agcagctaccaggtccacgaggcgcgcgcctatggcgccgacgtcgtcctgctgatcgtc
gcggcgctcgagcagaacgtgctcgtcggactgctggagcgggtcgagtccctcggcatg
acggcgctggtcgaggtgcacaccgaggccgaggccgaccgcgccctggccgccggcgcc
tcggtcatcggcgtcaacgcccgcgacctcaccaccctccaggtcgaccggtcgacattc
gagaagatcgcccccgggctgccgtcggaggtcgtgaaggtcgccgagtccggtgtccgc
ggcccgcacgacctgatcagctacgccgccgccggggccgacgcggtgctcgtcggcgag
ggcctggtcaccgccggggacgcccgccaggcggtggccgacctggtcacggccggctcg
cacccggccaccccgcgcaccacccgctga

DBGET integrated database retrieval system