KEGG   Blastococcus saxobsidens: BLASA_2279Help
Entry
BLASA_2279        CDS       T01752                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bsd  Blastococcus saxobsidens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLASA_2279 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLASA_2279 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLASA_2279 (trpB)
Enzymes [BR:bsd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BLASA_2279 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2180455..2181804
Genome map
AA seq 449 aa AA seqDB search
MTTTSPPQPGELSLPARPGWPDATGHFGVFGGRFVPEALIAALDELTEAYEAMRVDPAFL
AEFARLQRDYTGRPSPVTEVPKFAEHCGGARVLLKREDLNHTGSHKINNVLGQALLTKRI
GKSRVIAETGAGQHGVATATAAALMGLSCTVYMGEEDTRRQALNVARMRLLGAEVIPVTT
GSRTLKDAINEAFRDWVTNVETTNYVFGTVAGPHPFPAMVRDFQRVIGDEARAQVLEREG
RLPDAVLACVGGGSNAIGIFTAFVPDEDVRLLGLEAGGDGVDTDRHAATITGGTPGVLHG
ARSYLLQDENGQTIESHSISAGLDYPGVGPEHSYLHDIGRAEYRPVTDAEAMEAFALLCR
TEGIIPAIESAHALAGAMQLGQEMGTGALLLVNLSGRGDKDVETASRWFGLGDREEVDPG
PGLDTDQQPTEGAVSNDEAVRGDEAGKQA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccaccagcccgccgcagcccggagaactctccctcccggcgcgcccgggctgg
ccggacgccacggggcacttcggggtcttcggtggccgcttcgtgcccgaggcgctgatc
gcggcgctcgacgagctcaccgaggcctacgaggccatgcgcgtggaccccgccttcctc
gccgagttcgcccggctgcagcgggactacaccggccggcccagccccgtcaccgaggtg
ccgaagttcgccgagcactgcggcggcgcccgggtgctgctcaagcgagaggacctcaac
cacaccggctcgcacaagatcaacaacgtgctgggccaggcgctgctcaccaagcgcatc
ggcaagtcccgcgtcatcgccgagaccggggccggccagcacggcgtcgccacggcgacc
gctgccgcgctcatggggttgtcctgcaccgtgtacatgggcgaggaggacacccgccgg
caggcgctcaacgtggcccgcatgcgactcctgggcgccgaggtcatccccgtgaccacc
gggtcccgcacgctcaaggatgcgatcaacgaggcgttccgcgactgggtcaccaacgtg
gagaccaccaactacgtgttcggcaccgtcgccgggccgcacccgttcccggcgatggtc
cgcgacttccagcgggtcatcggcgacgaggcccgcgcccaggtcctggagcgggagggc
cggctgcccgacgccgtcctggcctgcgtcggcggtgggagcaacgcgatcggcatcttc
accgccttcgtgccggacgaggacgtgcggttgctcggcctggaggccggtggcgacggc
gtggacaccgatcggcacgcggccaccatcaccggcgggacgccgggtgtgctgcacggg
gcccgctcgtacctgctgcaggacgagaacggccagacgatcgagtcgcactccatcagc
gccggactcgactatcccggcgtcggccccgagcactcctacctgcacgacatcggccgg
gccgagtaccgcccggtcaccgacgccgaggcgatggaggcgttcgcgctgctctgccgc
accgagggcatcatcccggcgatcgagtccgcgcacgcgctcgccggcgcgatgcagctc
ggccaggagatggggacgggcgcgctgctgctggtcaacctctccggccgcggcgacaag
gacgtcgagacggcatcccgctggttcgggctgggcgaccgcgaggaggtcgaccccggc
ccggggctcgacaccgaccagcagcccaccgagggtgcggtcagcaacgacgaggccgtg
cgcggcgacgaggcggggaagcaggcatga

DBGET integrated database retrieval system