KEGG   Blastococcus saxobsidens: BLASA_2280Help
Entry
BLASA_2280        CDS       T01752                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bsd  Blastococcus saxobsidens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLASA_2280 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLASA_2280 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLASA_2280 (trpA)
Enzymes [BR:bsd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BLASA_2280 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2181801..2182601
Genome map
AA seq 266 aa AA seqDB search
MSALEDRIGAAKAEGRAALVAYLPVGYPDVDGSIAAMVAAVEAGADVIEVGVPYSDPGMD
GPVIQQAVDVAVRAGVGMRDVLRAVRAVADAGAVAVVMSYWNPIERYGVDRFATDLAAAG
GAGAITPDLIPDEAGEWIAASDRAGLDRVFLVAPSSTDARLATTAAACRGFVYAASTMGV
TGTRATVGDAAETLVARTRQAAPDRHVCVGLGVSDGDQAAEVAAFADGVIVGSAYVRELL
EGRGAAGVRALTEDLAAGVRRAGVRA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgctcgaggaccgcatcggggccgcaaaggccgaggggcgtgcggcgctggtc
gcctacctgccggtcggctatcccgacgtcgacgggtcgatcgccgccatggtggccgcc
gtcgaggccggcgccgacgtgatcgaggtcggcgtcccgtacagcgaccccggcatggac
ggccccgtcatccagcaggcggtcgacgtcgccgtccgcgcgggggtgggcatgcgggac
gtgctccgcgccgtccgggcggtggccgacgccggcgccgtcgccgtggtgatgagctac
tggaacccgatcgagcgctacggcgtcgaccgcttcgccaccgacctcgccgccgcaggc
ggcgcgggtgcgatcacccccgacctgatccccgacgaggcgggggagtggatcgccgcc
agcgaccgcgccggtctcgaccgggtcttcctcgtggcgccgtcgtccaccgacgcgcgg
ctggccacgacggcggccgcgtgccgcggcttcgtctacgccgcctccaccatgggcgtc
accggcacccgggcgaccgtcggcgacgcggccgagacgctggtggcccgcacccgccag
gcggcgccggaccggcacgtctgcgtcgggctgggggtctcggacggcgaccaggcggcc
gaggtggccgcgttcgccgacggggtcatcgtcggctcggcctacgtccgggagctgctc
gagggccgcggcgccgccggggtgcgcgccctgaccgaggacctcgccgcgggcgtccgg
cgcgcgggggtgcgggcgtga

DBGET integrated database retrieval system