KEGG   Blastococcus saxobsidens: BLASA_2280Help
Entry
BLASA_2280        CDS       T01752                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bsd  Blastococcus saxobsidens
Pathway
bsd00260  Glycine, serine and threonine metabolism
bsd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsd01100  Metabolic pathways
bsd01110  Biosynthesis of secondary metabolites
bsd01130  Biosynthesis of antibiotics
bsd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLASA_2280 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLASA_2280 (trpA)
Enzymes [BR:bsd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BLASA_2280 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB NeuB
Motif
Other DBs
NCBI-ProteinID: CCG03186
UniProt: H6RUL9
Position
2181801..2182601
Genome map
AA seq 266 aa AA seqDB search
MSALEDRIGAAKAEGRAALVAYLPVGYPDVDGSIAAMVAAVEAGADVIEVGVPYSDPGMD
GPVIQQAVDVAVRAGVGMRDVLRAVRAVADAGAVAVVMSYWNPIERYGVDRFATDLAAAG
GAGAITPDLIPDEAGEWIAASDRAGLDRVFLVAPSSTDARLATTAAACRGFVYAASTMGV
TGTRATVGDAAETLVARTRQAAPDRHVCVGLGVSDGDQAAEVAAFADGVIVGSAYVRELL
EGRGAAGVRALTEDLAAGVRRAGVRA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgctcgaggaccgcatcggggccgcaaaggccgaggggcgtgcggcgctggtc
gcctacctgccggtcggctatcccgacgtcgacgggtcgatcgccgccatggtggccgcc
gtcgaggccggcgccgacgtgatcgaggtcggcgtcccgtacagcgaccccggcatggac
ggccccgtcatccagcaggcggtcgacgtcgccgtccgcgcgggggtgggcatgcgggac
gtgctccgcgccgtccgggcggtggccgacgccggcgccgtcgccgtggtgatgagctac
tggaacccgatcgagcgctacggcgtcgaccgcttcgccaccgacctcgccgccgcaggc
ggcgcgggtgcgatcacccccgacctgatccccgacgaggcgggggagtggatcgccgcc
agcgaccgcgccggtctcgaccgggtcttcctcgtggcgccgtcgtccaccgacgcgcgg
ctggccacgacggcggccgcgtgccgcggcttcgtctacgccgcctccaccatgggcgtc
accggcacccgggcgaccgtcggcgacgcggccgagacgctggtggcccgcacccgccag
gcggcgccggaccggcacgtctgcgtcgggctgggggtctcggacggcgaccaggcggcc
gaggtggccgcgttcgccgacggggtcatcgtcggctcggcctacgtccgggagctgctc
gagggccgcggcgccgccggggtgcgcgccctgaccgaggacctcgccgcgggcgtccgg
cgcgcgggggtgcgggcgtga

DBGET integrated database retrieval system