KEGG   Blastococcus saxobsidens: BLASA_2324Help
Entry
BLASA_2324        CDS       T01752                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase subunit RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bsd  Blastococcus saxobsidens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BLASA_2324 (ruvA)
Enzymes [BR:bsd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BLASA_2324 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2227663..2228295
Genome map
AA seq 210 aa AA seqDB search
MIASVSGRVAAVSPDGAVVEVGGIGLAVQCTPGTIARLRVGEAARLATSLVVREDSLTLY
GFADDDERQLFELLQTANGVGPRLAQAVLAIHPPREVRRAVSTADVKALMQVSGIGKKGA
ERLILELRDRLGSTSTDTTLDAPAGLSQVTPVAPWRDQLSSALAGLGWSAKEAEGAVAEL
APVADAQIAATGGVEVAVLLRQALQLLGRS
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgccagtgtgagtggccgggtcgccgcggtcagcccggacggcgcggtggtcgag
gtcggggggatcggcctcgcggtgcagtgcacccccggcacgatcgcccggctgcgggtg
ggcgaggctgcccggctggccaccagcctcgtggtgcgggaggactcgctcaccctctac
ggcttcgccgacgacgacgagcgccagctgttcgaactgctgcagacggcgaacggcgtg
ggcccgcggctggcccaggccgtcctggccatccacccgccgcgggaggtccgccgcgcc
gtctcgacggccgacgtcaaggcgctcatgcaggtgtccggcatcgggaagaagggcgcc
gagcggctgatcctggagctgcgcgaccggctcgggtccaccagcaccgacaccacgctg
gacgcgcccgccgggctgtcgcaggtgacgccggtcgccccgtggcgggaccagctctcc
tccgccctggcgggtctcgggtggtcggccaaggaagcggagggcgcagtggccgagctc
gccccggtggccgacgcgcagatcgccgccaccggcggtgtcgaggtggccgtcctgctg
cggcaggcgctccagctgctgggcaggtcatga

DBGET integrated database retrieval system